(data stored in ACNUC7421 zone)

EMBL: CP000438.PE376

CP000438.PE376       Location/Qualifiers
FT   CDS_pept        417456..418442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15324"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL48"
FT                   /protein_id="ABJ15324.1"
FT                   /translation="MFSQWVFLSVLALAVPSFAWAEDAVSDLAKEQSKAEQGDKRGDEL
FT                   FAEFTRLRQAAETGEPQALFDFGAYFYQQQNYASAREWWGKAAAAGMVRAQIQLAMLYR
FT                   DGDGGPQDKTEAARWFRKAAEQGDAAAQNEMGVLYWRGEGVDQDRVKAGTWFERAAASG
FT                   SEDAETNLGWFYLDDSQGVYSATSDEEAALLDRYAGSREKAFQWFCKAATQGDARAQFK
FT                   VGEAYWNGSGAGMNKLQARLWLEKAAQQQDADAIAWLESAANAAWYTRLENWIHAALDG
FT                   ELSGVADCSGVADRRHSGRGMEGASSEPEAVEASAEDAQQAAEAASQ"
     atgttcagtc agtgggtgtt cctgtccgtc cttgctcttg ccgtaccctc gttcgcctgg        60
     gcggaggatg cggtgtccga cctcgccaag gagcagtcca aggccgagca gggcgacaag       120
     cgcggcgatg aactgttcgc cgaattcacc cgcctccgcc aggccgccga gacgggggag       180
     ccgcaggctc tgttcgattt cggcgcctac ttctaccagc aacagaacta cgccagcgcg       240
     cgcgaatggt ggggcaaggc ggccgctgcg gggatggtcc gcgcgcagat ccaactggcc       300
     atgctctatc gcgatggtga cggcgggcca caggacaaga ccgaggcggc acgctggttc       360
     cggaaggccg cggagcaggg ggatgccgcc gcccagaatg aaatgggcgt tctctactgg       420
     agaggcgaag gggtcgacca ggaccgggtg aaggccggga cctggttcga acgtgcggcg       480
     gccagcggta gcgaagacgc cgaaaccaat ctgggatggt tctacctgga cgactcgcaa       540
     ggcgtctatt ccgccacttc agacgaggaa gccgccctgc tggaccgtta tgccggcagc       600
     cgggaaaagg ccttccagtg gttctgcaag gctgcgaccc agggagatgc ccgtgcccag       660
     ttcaaggtgg gcgaggccta ctggaacggt tccggtgccg ggatgaacaa gctgcaagca       720
     cggctctggc tggaaaaggc cgcacagcag caggatgcgg atgccatcgc ctggctggag       780
     agcgccgcga acgcagcctg gtacacccgt ttggaaaact ggattcacgc tgcgctggat       840
     ggagagctgt ccggcgtcgc cgactgctcc ggtgtcgccg atcgccggca ctccggccga       900
     ggcatggagg gcgcctcgtc tgaaccggag gcggtggaag ccagtgcgga ggatgcgcaa       960
     caggcggctg aagcggcgag ccagtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page