(data stored in ACNUC7421 zone)

EMBL: CP000438.PE377

CP000438.PE377       Location/Qualifiers
FT   CDS_pept        complement(418555..418986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF6"
FT                   /protein_id="ABJ15325.1"
FT                   /translation="MSLFRPLLIASTLALASGCASGLNSQQTAELEYYEARNLAVIEKS
FT                   PGTGAALGLLPGGGSFYGRSYGLGVVNLLFWPLSILWDPVSGYDASQRINYTATRVHLE
FT                   KLRQRDFDELQRLADNGALDGATLARKRQDVETKYRYTP"
     atgtcgctgt ttcgtcccct cctgatcgcc tccaccctcg ccctcgccag cggttgcgcc        60
     agcggcctca actcgcagca gacggccgaa cttgagtatt acgaagcccg caacctggcg       120
     gtcatcgaga aatcccccgg caccggcgcg gccctcggcc tgctccccgg cggcggctcc       180
     ttctacggcc gttcctacgg actcggggtg gtcaacctgc tgttctggcc gctgtcgatc       240
     ctctgggacc cggtgagcgg ctacgacgca tcccagcgca tcaactacac cgcgacccgg       300
     gtgcacctgg agaagctgcg ccagcgcgac ttcgacgaac tgcaacggct ggccgacaac       360
     ggcgcattgg acggcgccac gctggcgcgg aagcgccagg acgtggaaac gaaataccgc       420
     tacaccccct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page