(data stored in ACNUC7421 zone)

EMBL: CP000438.PE382

CP000438.PE382       Location/Qualifiers
FT   CDS_pept        complement(423650..424198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15330"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL54"
FT                   /protein_id="ABJ15330.1"
FT                   /translation="MSDTTLESAGLSRRSLMKVGLIGGAFLATAGVTASLTGCSAEKPA
FT                   SGLEKVRESDLPFLRALLPVMLLGAVSAEQMPKAVEGAIQSLDHNLARLSPEMFKLTQQ
FT                   LFDVLALPLTRGPLTGIWGSWENASGDDVRAFLSRWENSFIGLLRMGHSSLMQLAMMAW
FT                   YARPEAWAHCGYPGPPKIA"
     atgagcgaca ccactctcga aagcgccggc ctgtcccgac gcagcctgat gaaagtcggc        60
     ctgatcggcg gcgccttcct cgccaccgcg ggcgtcaccg ccagcctcac cggctgttcg       120
     gcggagaaac cggcgagcgg cctggaaaag gtccgcgaat ccgacctgcc gttcctccgt       180
     gcgctgctgc cggtgatgct gctcggcgcg gtttccgccg agcagatgcc gaaagccgtg       240
     gagggcgcga tccagagcct cgaccacaac ctggcgcggc tctccccgga gatgttcaag       300
     ctcacccagc aactcttcga cgtgctcgcc ctgccgctca cccgtggccc gctgaccggt       360
     atctggggca gttgggagaa cgccagcggc gacgacgtgc gggcattcct ttcgcgctgg       420
     gaaaacagct tcatcggcct gttgcggatg ggccacagtt cgctgatgca actggcgatg       480
     atggcctggt acgcccgccc cgaggcgtgg gcccattgtg gctaccccgg accgccgaag       540
     atcgcttga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page