(data stored in ACNUC7421 zone)

EMBL: CP000438.PE395

CP000438.PE395       Location/Qualifiers
FT   CDS_pept        436338..436943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15343"
FT                   /db_xref="GOA:A0A0H2ZL06"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL06"
FT                   /protein_id="ABJ15343.1"
FT                   /translation="MPRNTRWLFYLSLAVLTFVVGAWLVRTPEPARPLPWLADWQEQVL
FT                   APLADNALTLRQLHDAVDGELWVDPRLDGVRLAFRGRLLGDGGPWQVEGELGLSAEEQL
FT                   SLQRASALQPGSAPQPLSAGLEGQLGDKPIVALSMIPEGRVGAERLLASLGQPRLRLQL
FT                   AQGEAWVYPQLGLTAHLPDDDLRLMLAVPRQALEKPPR"
     atgccgcgca atacccgctg gctgttctac ctgtcgctgg cggtcctgac cttcgtcgtc        60
     ggtgcctggc tggtccgtac gccggaaccg gcgcggccgt tgccgtggct ggccgactgg       120
     caggagcagg tgctggcgcc gttggcggac aacgccctga ccctgcgcca gctgcacgac       180
     gcggtggatg gcgagctgtg ggtggacccg cgcctggatg gcgtgcgcct ggccttccgt       240
     ggccgcctgc tgggcgacgg cggcccctgg caggtggaag gcgagctggg tctgagcgcc       300
     gaggagcaac tgagcctgca gcgggcatcc gcgttgcagc ctggcagcgc gccgcagcca       360
     ttgagcgccg gattggaagg acagttgggc gacaagccga tcgtggcgct gagcatgatt       420
     cccgaaggca gggttggtgc cgagcggctg ctggccagtc tcggccagcc gcgcctgcgc       480
     ctgcaactgg cccagggcga ggcctgggtc tatccgcaac tgggcctgac cgcgcacctg       540
     ccggacgacg acttgcggct gatgctcgcg gtgccgcgcc aggccctgga aaaaccgccg       600
     cgttga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page