(data stored in ACNUC7421 zone)

EMBL: CP000438.PE397

CP000438.PE397       Location/Qualifiers
FT   CDS_pept        437716..438093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04960"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15345"
FT                   /db_xref="GOA:A0A0H2ZL73"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL73"
FT                   /protein_id="ABJ15345.1"
FT                   /translation="MLRPFLLLAAFFGFTGVALGAFAAHGLKKQLSAEYLAVFQTGVHY
FT                   QLIHALALFGVALLATRLDGRLVSAAGGLFTLGILLFSGSLYLLTLSGIGKLGIVTPFG
FT                   GVSFLAGWLCLGLAAWRLGNA"
     atgcttcgtc ccttcctgtt gttggcggca tttttcggtt tcaccggcgt ggccctcggg        60
     gcgttcgccg cccacggcct gaagaagcag ctcagcgccg agtacctggc ggtattccag       120
     accggcgtgc actaccagtt gatccacgcc ctggcgctgt tcggcgtggc gctgctcgcc       180
     acccgcctgg acggccgcct ggtgagcgcg gcgggtggcc tgttcacgct gggcatcctg       240
     ctgttctccg gcagcctcta cctgctgacc ctcagtggca tcggcaagct cggcatcgtc       300
     accccgttcg gcggcgtctc cttcctcgcc ggctggctgt gcctggggct ggccgcctgg       360
     cgcctgggca acgcctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page