(data stored in ACNUC7421 zone)

EMBL: CP000438.PE401

CP000438.PE401       Location/Qualifiers
FT   CDS_pept        440240..441586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15349"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK31"
FT                   /protein_id="ABJ15349.1"
FT                   /translation="MLKKLGILLLGAGCAWAAQAKVDEVQAARLDQDLTPLGAERAGNA
FT                   DGSIPPWTGGITQAPAGYRPGMHHLDPFAADRPRLVVDSRNMAAYQALLTPGTQALLQA
FT                   NPDYHLRVFPSRRSASLPQRLYDATRANASRAELIADGNGVQGAAAGVPFPLPQSGQEA
FT                   IWNHIMRYRGEQLHLQTNQAAVLANGSYNLLKLDRYLYFVYGREGMIPENLDNTLFYYK
FT                   YKVVAPARLAGSALVVQETLDQVLSIRKAWRFNRGERRVRRLPTLAYDSLQPDTNGMAT
FT                   ADTVDVYNGAPDHYEWALLGKREMLVPYNSYAVHQKGLAYGDILKSRFINPDLLRYELH
FT                   RVWVVEATLRKGFSHPYAKRRFYLDEDSWQILAADIYDKDGVLTRAQEVHPINYYDVPL
FT                   VSSTLEAIYDFKGGRYFVDGLDNNEPMYDFGVQVGPRDFTPQALRREGN"
     gtgttgaaga aactgggcat cctgttgctc ggggccggtt gcgcctgggc ggcgcaggcc        60
     aaggtagacg aagtccaggc cgcacgcctg gaccaggacc tgaccccgct gggagcggag       120
     cgggccggca acgccgatgg cagcatcccg ccctggaccg gcggcatcac ccaggcgccg       180
     gccggctacc ggcccggcat gcatcacctc gacccgttcg ccgccgatcg tccgcgcctg       240
     gtcgtcgaca gccgcaacat ggccgcctac caggcgctgc tgacgccggg cacccaggcc       300
     ttgctgcagg ccaacccgga ctaccacctg cgggtcttcc cctcccgccg cagcgcatcc       360
     ctgccgcagc gcctgtacga cgctacccgc gccaacgcca gccgcgccga gctgatcgcc       420
     gacggcaacg gcgtgcaagg cgctgccgcc ggtgtgccct tccccctgcc gcagagcggc       480
     caggaagcga tctggaacca catcatgcgc taccgcggcg agcaactgca cctgcagacc       540
     aaccaggcgg cggtgctggc caacggcagc tacaacctgc tcaagctcga ccgctacctg       600
     tacttcgtct atggccgcga ggggatgatc ccggagaacc tcgacaacac gttgttctac       660
     tacaagtaca aggtggtcgc gccggcgcgc ctggccggtt cggcgctggt ggtgcaggaa       720
     accctcgacc aggtgctgtc gatccgcaag gcctggcgct tcaaccgtgg cgagcggcgc       780
     gtgcggcgct tgccgaccct ggcctacgac agcctgcagc cggataccaa cggcatggcc       840
     acggcggaca ccgtggatgt ctacaacggc gcaccggacc actacgagtg ggcgttgctc       900
     ggcaagcgcg agatgctggt gccttacaac agctacgcgg tgcaccagaa gggcctcgcc       960
     tatggcgaca tcctcaagag ccgcttcatc aatcccgacc tgctgcgcta cgagctgcat      1020
     cgcgtctggg tggtcgaggc gaccctgcgc aagggcttca gccatcccta cgccaagcgc      1080
     cgcttctacc tcgacgaaga cagctggcag atcctcgccg ccgacatcta cgacaaggat      1140
     ggcgtgctga cccgggccca ggaggtccat ccgatcaact actacgatgt gccgctggtc      1200
     tccagcaccc tggaagcgat ctacgacttc aagggcggcc gctacttcgt cgatgggctg      1260
     gacaacaacg agccgatgta cgacttcggc gtacaggtcg ggccgcgcga cttcaccccg      1320
     caggcgctgc gccgggaggg taactga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page