(data stored in ACNUC7421 zone)

EMBL: CP000438.PE402

CP000438.PE402       Location/Qualifiers
FT   CDS_pept        complement(441599..441856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL11"
FT                   /protein_id="ABJ15350.1"
FT                   /translation="MKPIKHLYLHFTDGQRLSLRFPRQQDDPAEVARSIRQQLDTPYLS
FT                   VEVDGDLLLIPRDSIKYLQISPAPARLDDDGTLRGAELIV"
     atgaaaccga tcaagcacct ctatctgcat ttcaccgacg gccagcgcct gtcgctgcgc        60
     ttcccgcgcc agcaggacga cccggccgag gtcgcccgca gtatccgcca gcagctggac       120
     acgccctatc tcagcgtcga ggtcgacggc gacctgctgc tgatcccgcg ggacagcatc       180
     aagtacctgc agatcagccc ggcgccggcg cgcctggacg acgacggcac gctgcgcggc       240
     gccgagctga tcgtctga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page