(data stored in ACNUC7421 zone)

EMBL: CP000438.PE403

CP000438.PE403       Location/Qualifiers
FT   CDS_pept        complement(441918..442241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15351"
FT                   /db_xref="GOA:A0A0H2ZKU4"
FT                   /db_xref="InterPro:IPR021813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU4"
FT                   /protein_id="ABJ15351.1"
FT                   /translation="MDYALDLIATLSRWSRSHLSDISLAIMATLLVLFGPAINAWVQQR
FT                   IGSLNFVFRTLLFVLICAVGYGLAMVFVTPWLAKGLGYFNNYTLAPVLLLVFFVIGMIA
FT                   DRS"
     atggattacg cgctggacct gatcgccacc ctgtcgcgct ggagccgcag ccacctgtcg        60
     gacatttccc tggccatcat ggccaccctg ctggtgctgt tcggcccggc gatcaacgcc       120
     tgggtacagc agcgcatcgg cagcctcaac ttcgtcttcc gcaccctgct gttcgtgttg       180
     atctgcgcgg tcggctacgg cctggcgatg gtcttcgtca ccccctggct ggccaagggc       240
     ctcggctact tcaacaacta caccctggcg cccgtgctcc tgctagtgtt cttcgtgatc       300
     ggcatgatcg ccgatcgcag ctga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page