(data stored in ACNUC7421 zone)

EMBL: CP000438.PE406

CP000438.PE406       Location/Qualifiers
FT   CDS_pept        complement(444187..444606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15354"
FT                   /db_xref="InterPro:IPR025218"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK38"
FT                   /protein_id="ABJ15354.1"
FT                   /translation="MRRFTAFVLGLCLSLPVLAEQVQRFGDLDVHYNVFNSSFLQPNVA
FT                   SAVGLVRSKAQGVINVVPMEKGKPVEASVTGSAKDLTGKVIPLEFRRVSEEGAIYNLAQ
FT                   FPISQRETLVFTIKVEAKGEPAQTFSFNKEIFPDE"
     atgcgccgct tcaccgcttt cgtcctcggc ctctgcctga gcctgccggt cctcgccgag        60
     caggtgcagc gcttcggcga cctggacgtc cactacaacg tgttcaactc cagcttcctc       120
     caacccaacg tggccagcgc ggtcggcctg gtacgcagca aggcgcaggg cgtgatcaac       180
     gtggtgccga tggagaaagg caagccggtg gaagccagcg tgaccggctc cgccaaggac       240
     ctgaccggca aggtcattcc cctggagttc cgccgggtca gcgaggaagg cgccatctac       300
     aacctggcgc aattcccgat cagccagcgc gagaccctgg tcttcaccat caaggtcgag       360
     gccaagggcg aacctgcgca aaccttcagt ttcaacaagg aaatcttccc ggacgaatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page