(data stored in ACNUC7421 zone)

EMBL: CP000438.PE409

CP000438.PE409       Location/Qualifiers
FT   CDS_pept        complement(446594..448561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15357"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU7"
FT                   /protein_id="ABJ15357.1"
FT                   /translation="MSMERLSHQIDAYVAWKRELMREITRYRGWLERSRLNSPAVEAKL
FT                   ERALRQLRADHITLAFVGEFSRGKTELINSLFFAGYGQRMLPSHAGRTTMCPTELFHDP
FT                   RAERSYIRLLPIETRLADASVAQFKRVPRHWVNIPLDTGDPEGMAQAFAQVAKTKALPV
FT                   EQAIQLGFHPDALEAADEPDQVRVPAWRHALVNFDHPLLRQGLRILDTPGLNALGSEPE
FT                   LTLSMLPNAQAILFLLSADAGVTASDMEIWQKYIQPLREDGHSSLFAVLNKIDVLWDDL
FT                   SGERFVQNAIRLIQDGTARQLGLQRGDVLPLSAKQALLAKVRGEPALLERSRLDRLEAL
FT                   LCERIVAQKEALLENAVLGQVLGLLHNSQHLLRLRLEKVEEQRALLDDKQRDSGQLLFE
FT                   LTAKTKDDHGRHHRRLLNLKTNQRLLQHQGATLRETIRSERMEQHLQKVRRNLNGSLTT
FT                   VGINQAILAFFRAVEHDLDNLEHEAGMANRMVAAIYRRHNEENPLYALDAPQLRVQRYQ
FT                   RELLQLKKKGDQFRLQLKTVLTEQRLLTRRFFATLVQEVVGLHQRLREETERWANDALM
FT                   PLMQHTLENKQLLESHMLRLKGLAQETQQVRQRSQAFAGFAEELQEQLREAGDILRQLR
FT                   RPSPLQRQAKVVNLPGSQRA"
     atgagcatgg aaagactcag ccatcaaatc gacgcctacg tcgcctggaa gcgcgagctg        60
     atgcgggaaa tcacccgcta tcgcggctgg ctggagcgca gccggctgaa cagcccggcg       120
     gtcgaggcca agctcgaacg cgccctgcgc caactgcgcg cggaccacat caccctggcc       180
     ttcgtcggcg agttctcgcg tggcaagacc gagctgatca acagcctgtt cttcgccggc       240
     tacggccagc gcatgctgcc gtcccacgcc gggcgcacca ccatgtgccc caccgagctg       300
     ttccacgatc cgcgcgccga gcgcagctac atccgcctgc tgccgatcga gacgcgcctg       360
     gccgacgcca gcgtcgccca gttcaagcgc gtgccgcgcc actgggtgaa cattccgctg       420
     gacaccggcg acccggaggg catggcccag gccttcgccc aggtcgccaa gaccaaggcg       480
     ctgccggtgg aacaggcgat ccagctcggc ttccatccgg atgccctgga agccgccgac       540
     gaacccgacc aagtgcgcgt cccggcctgg cgccacgccc tggtcaactt cgaccacccg       600
     ctgctgcgcc agggcctgcg gatcctcgac acgcccggcc tgaacgccct cggcagcgag       660
     ccggagctga ccctgtcgat gctgcccaac gcccaggcga tcctgttcct gctgtccgcc       720
     gacgccggtg tcaccgcctc ggacatggaa atctggcaga agtacatcca gccactgcgc       780
     gaggacggcc acagcagcct gttcgccgtg ctgaacaaga tcgacgtgct ctgggacgac       840
     ctctccggcg agcgcttcgt acagaacgcc atccgcctga tccaggacgg cacggcccgc       900
     cagctcggcc tgcagcgcgg cgacgtgctg ccgctgtcgg cgaagcaggc gctgctggcc       960
     aaggtccgcg gcgaaccggc gctgctcgaa cgcagtcgcc tggatcggct ggaagcactg      1020
     ctctgcgagc gcatcgtcgc gcagaaggaa gcgctgctgg agaacgccgt gctcggccag      1080
     gtcctcggcc tgctgcacaa cagccagcat ctgctgcgcc tgcgcctgga gaaggtcgag      1140
     gaacagcgcg cgctgctcga cgacaagcag cgcgacagcg gccaactgct gttcgaactg      1200
     accgcgaaga ccaaggacga ccacggccgc caccaccgcc gcctgctcaa cctgaagacc      1260
     aaccagcgcc tgctgcagca ccagggcgcg acgctgcgcg agacgatccg cagcgaacgc      1320
     atggaacagc acctgcagaa ggtgcggcgc aacctcaacg gcagcctgac cacggtcggc      1380
     atcaaccagg cgatcctggc gttcttccgc gcggtggagc acgacctcga caacctcgag      1440
     cacgaggccg gcatggccaa ccgcatggtc gccgccatct accgccggca caacgaggag      1500
     aacccgctct acgccctcga cgcgccgcag ctgcgggtcc agcgctacca gcgcgaactg      1560
     ttgcaactga agaagaaggg cgaccagttc cgcctgcagc tgaagaccgt gcttaccgag      1620
     caacgcctgc tgacccggcg cttcttcgcc accctggtgc aggaggtggt cggcctgcac      1680
     cagcgcttgc gcgaggaaac cgagcgctgg gccaacgacg cgctgatgcc gctgatgcag      1740
     cacaccctgg aaaacaaaca gttgctcgaa agccacatgc tccgcctcaa gggcctggcc      1800
     caggagaccc agcaggtacg ccagcgcagc caggccttcg ccgggttcgc cgaggaattg      1860
     caggaacagt tgcgcgaagc cggcgacatc ctccgccagt tgcgccgccc ctcgcccctg      1920
     cagcgccagg ccaaggtggt caacctgccc ggctcgcagc gcgcctga                   1968
//

If you have problems or comments...

PBIL Back to PBIL home page