(data stored in ACNUC7421 zone)

EMBL: CP000438.PE41

CP000438.PE41        Location/Qualifiers
FT   CDS_pept        41133..42821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00490"
FT                   /product="putative hemolysin activation/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14997"
FT                   /db_xref="GOA:A0A0H2ZJZ8"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ8"
FT                   /protein_id="ABJ14997.1"
FT                   /translation="MALHRLAFIFLCLPLMASAAPFTSPGDRDLIRDRQQRLLDEQRKR
FT                   LEELQQLPGKGAPAAADASGDDERCFEIRRIEMEGAGHLGESARRQLLAPYQGRCLGVG
FT                   QLNALLKAVTDHYLDRGYVTTRAYLPQQDLASGTLRIIVVEGRLEGLDSSALASPRELA
FT                   MSFPGRTGELLDLRELEQLVDQLSRLPSRQAQLELVPGSEVGGSRVRLKGERDKPWRVS
FT                   ATRNNDGDVSTGEQQMGLGLDWDSPLGLADQLNLRANRDAVTDRWRHSDSQSLFYSLPW
FT                   GWWTFTYGYSQSDYRTRNEASGFPFKLDGDSRSHQFRAERVLHRDGVSKTAMSLGLSHQ
FT                   RTNNYVEDTRLEDQSTRITETQLGFNHGRRIGSGFVNLDLGWQQGIGALGAQGRGHPQA
FT                   GDPNARYDKYSLTLSYLQPFQLWGERFSFDSLATGQRSEDVLFSPQRISLGGNSSVRGF
FT                   KDQTLTGDSGGYWRNQLRWRRAVEWAPLRPWLQEYGVAFAYDVGVIRHDRYNDGASGRM
FT                   SGNAIELDARGRYFAASVGFARSLERPSAIERREHPIYFRVDAFF"
     gtggctctcc atcgcctggc ctttatcttc ctgtgcctgc cgctcatggc cagcgccgcc        60
     cccttcacct cccccggcga ccgcgacctg atccgcgacc gccagcagcg cctgctggac       120
     gaacagcgca agcgcctgga ggaactccag caactgcccg gcaagggagc gcccgccgct       180
     gcggatgcct ccggcgacga cgagcgctgc ttcgagatcc gccgcatcga gatggaaggc       240
     gccgggcacc tcggcgaaag cgcgcgtcgc caactgctgg cgccctacca ggggcgctgc       300
     ctgggcgtcg gccagctcaa tgcgctgctc aaggccgtca ccgaccatta cctggatcgc       360
     ggctacgtca ccacccgcgc ctacctgcca cagcaggacc tggcctccgg gaccctgcgc       420
     atcatcgtcg tcgaaggccg cctggagggc ctggacagct ccgcgctggc cagcccgcgc       480
     gaactggcga tgagctttcc gggcaggacc ggcgagctgc tcgacctgcg cgaactggag       540
     caactggtcg accagttgag tcgcctgccg tcgcgccagg cgcaactgga gctagtgccc       600
     ggcagcgagg tcggcggcag tcgggtgcgt ctcaagggcg agcgcgacaa gccctggcgg       660
     gtctccgcca cgcgcaacaa cgacggcgac gtcagcaccg gcgagcagca gatgggcctg       720
     ggtctggact gggacagccc gctgggcctg gccgaccagc tcaacctgcg cgccaaccgc       780
     gacgcggtga ccgaccgctg gcgccattcc gacagccaga gcctgttcta cagcctgccc       840
     tggggctggt ggaccttcac ctacggctac agccagagcg actaccgcac gcgcaacgag       900
     gccagcggct tccccttcaa gctcgatggc gacagccgca gccaccagtt ccgcgccgaa       960
     cgcgtgctgc accgcgacgg tgtgagcaag accgccatga gcctggggct cagccaccag      1020
     cgcaccaaca actatgtcga agacacccgc ctggaagacc agagcacgcg gatcaccgag      1080
     acccagctcg gcttcaacca tggccggcgg atcggcagtg gcttcgtcaa cctcgacctc      1140
     ggctggcagc agggcatcgg cgcccttggc gcgcagggtc gcggccaccc gcaggcgggc      1200
     gatccgaatg cgcgctacga caagtacagc ctgaccctca gctacctgca gccgttccag      1260
     ctatggggcg agcgcttcag cttcgacagc ctggccaccg ggcagaggag cgaggacgtg      1320
     ctgttcagcc cgcagcgcat cagcctcggc ggcaacagct cggtgcgcgg cttcaaggac      1380
     cagaccctga ccggcgacag cggcggctac tggcgcaacc agttgcgctg gcggcgtgcg      1440
     gtggaatggg cgccgctgcg gccctggctg caggaatacg gcgtggcctt cgcctacgac      1500
     gtcggcgtga tccgccacga ccgctacaac gacggcgcca gcgggcgcat gagcggcaac      1560
     gccatcgaac tggatgcccg cggccgctat ttcgccgcca gcgtcggctt cgcccgctcg      1620
     ctggagcggc ccagcgccat cgagcggcgc gagcacccga tctatttccg ggtcgacgcg      1680
     ttcttctga                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page