(data stored in ACNUC7421 zone)

EMBL: CP000438.PE410

CP000438.PE410       Location/Qualifiers
FT   CDS_pept        complement(448669..448839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05120"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15358"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL83"
FT                   /protein_id="ABJ15358.1"
FT                   /translation="MEGKANAHLLAFLGKAFGVAKSLVSLESGELNRQKRVRIRRPTRL
FT                   PEELGITARPA"
     gtggagggca aggccaacgc ccatctgctg gccttcctcg gcaaggcctt cggcgtggcc        60
     aagagcctgg tgagtctcga aagcggcgag ctgaaccggc agaaacgggt gcgcatccgc       120
     cgtccgaccc gattgccgga ggaactgggg atcaccgctc gacccgcttg a                171
//

If you have problems or comments...

PBIL Back to PBIL home page