(data stored in ACNUC7421 zone)

EMBL: CP000438.PE411

CP000438.PE411       Location/Qualifiers
FT   CDS_pept        complement(448962..449555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05130"
FT                   /product="putative YGGT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15359"
FT                   /db_xref="GOA:A0A0H2ZKH5"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH5"
FT                   /protein_id="ABJ15359.1"
FT                   /translation="MIGLNTAAIYILQTLGSLYLLIVLLRFILQLVRADFYNPLSQFIV
FT                   RATKPLLNPLRRIIPGFGGIDLASLVLAILIQLVLMILILMLMGYGVGGFIMQLLIWSI
FT                   IAVTSLFLKVFFFALIISVILSWVAPGSYNPGAQLVNQICEPLLMPFRKLLPNLGGLDL
FT                   SPIFAFLALKLIDMLVINNLAAMTGMPQQLSIFL"
     atgatcggcc tcaacaccgc tgctatctat atcctccaga ccctcggcag cctctacctg        60
     ctgatcgtgc tgctgcgctt catcctgcaa ctggtccgcg cggacttcta caaccccctc       120
     agccagttca tcgtgcgcgc caccaagccg ctgctgaacc cgctgcggcg gatcatcccc       180
     ggcttcggcg ggatcgacct ggcctcgctg gtgctggcga tcctgatcca actggtgctg       240
     atgatcctga tcctgatgct gatgggctac ggcgtcggcg gcttcatcat gcaactgctg       300
     atctggtcga tcatcgccgt cacctcgctg ttcctgaagg tgttcttctt cgccctgatc       360
     atcagcgtga tcctttcctg ggtcgccccg ggcagctaca accccggcgc gcaactggtg       420
     aaccagatct gcgaaccgct gctgatgccg ttccgcaagc tcctgccgaa cctcggcgga       480
     ctggatctct cgccgatctt cgcgttcctc gcgctgaagc tgatcgacat gctggtgatc       540
     aacaacctgg cggccatgac cggcatgccc cagcagttga gcatcttcct ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page