(data stored in ACNUC7421 zone)

EMBL: CP000438.PE413

CP000438.PE413       Location/Qualifiers
FT   CDS_pept        complement(450399..451091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05160"
FT                   /product="putative PLP dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15361"
FT                   /db_xref="GOA:A0A0H2ZL20"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL20"
FT                   /protein_id="ABJ15361.1"
FT                   /translation="MSTIAENIAKVAARIREAAQAAGRDPATVGLLAVSKTKPAAAVRE
FT                   AHAAGLRDFGENYLQEALGKQAELADLPLNWHFIGPIQSNKTRPIAEHFQWVHSVDRLK
FT                   IAQRLSEQRPAGLPLLNVCLQVNVSGEASKSGCAPEDLPALAEAVKQLPNLRLRGLMAI
FT                   PEPTAERAAQHAAFARLRELLLDLNLGLDTLSMGMSDDLEAAIGEGATWVRIGTALFGA
FT                   RDYGAPAS"
     atgtccacga tagcagagaa tattgcaaag gttgccgcac gcatccgtga ggcagcgcaa        60
     gctgcggggc gcgatccggc cacggtcggc ctgctcgccg tgagcaagac caagcccgcc       120
     gccgcggtgc gcgaggcgca cgccgccggc cttcgcgact tcggcgaaaa ctacctgcag       180
     gaggccctcg gcaagcaggc cgaactggcc gacctaccct tgaactggca cttcatcggc       240
     cccatccagt cgaacaagac gcggcccatc gccgagcatt tccagtgggt gcactcggtg       300
     gaccggttga agatcgcgca gcgcctgtcg gagcaacgcc cggccgggct gccgctcctg       360
     aatgtctgcc tgcaggtcaa cgtcagcggc gaagccagca agtccggctg cgcccccgag       420
     gacctgccgg ccctggccga ggccgtgaag caactgccca acctccgatt gcgtggcctg       480
     atggccatcc ccgaacccac cgccgaacgc gccgcgcaac acgccgcgtt cgcccgcctg       540
     cgcgaactgc tgctggacct gaaccttggc ctggacaccc tgtccatggg catgagcgac       600
     gacctcgagg cagccatcgg cgaaggtgcg acctgggtcc gcatcggtac cgccctgttc       660
     ggcgcccgcg actacggcgc gccggcttct tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page