(data stored in ACNUC7421 zone)

EMBL: CP000438.PE417

CP000438.PE417       Location/Qualifiers
FT   CDS_pept        454728..455132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05210"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15365"
FT                   /db_xref="GOA:A0A0H2ZK47"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK47"
FT                   /protein_id="ABJ15365.1"
FT                   /translation="MTQQHDTHSKAIGYLLWIFGFTGSHRFYYGKPITGTIWFFTFGLF
FT                   FIGWIIDLFLIPSMDREADRRFQGGNLDYNVAWILLTFLGVLGVHRMYMGKWITGIIYL
FT                   FTGGLFFLGVLYDFWTLNGQVSERNGPQRI"
     atgactcaac agcacgacac ccatagcaag gccatcggct acctgctgtg gatcttcggt        60
     ttcaccggtt cgcaccgctt ctattacggc aagccgatca ccgggacgat ctggttcttc       120
     accttcggcc tgttcttcat cggctggatc atcgacctgt tcctcatccc gtcgatggac       180
     cgcgaggccg accggcgctt ccagggcggc aacctggact acaacgtggc ctggatcctg       240
     ctgaccttcc tcggcgtgct cggcgtgcac aggatgtaca tgggcaagtg gatcaccggg       300
     atcatctacc tgttcaccgg cggcctgttc ttcctcggcg tgctctacga cttctggacc       360
     ctcaacggac aggtgtccga gcgcaacggg ccgcagcgca tctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page