(data stored in ACNUC7421 zone)

EMBL: CP000438.PE425

CP000438.PE425       Location/Qualifiers
FT   CDS_pept        complement(462129..463088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05300"
FT                   /product="putative tonB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15373"
FT                   /db_xref="GOA:A0A0H2ZKI4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI4"
FT                   /protein_id="ABJ15373.1"
FT                   /translation="MRHRLFRPPSADFAPRQPPRSAMNAAVLKSPSAAAGVRPADRLGF
FT                   TLFIAAILHVAFILGVGFSMPAPSQISKTLEITLATFKSDKAPEKADYLAQMNQQGSGT
FT                   LEHKAAPKTTEVAPFQDNQVKKVAPPATPKQARSEEAPKAAVTTTRQRQQKAPSKTQAQ
FT                   KAEQVAKPAPHFDSTQLSAEIASLEADLAKEQQAYAKRPRIHRLSAASTMRDKGAWYKE
FT                   DWRKKIERIGNLNYPDEARRQKLYGSLRLLVSINRDGTIYEVQVLESSGEPILDQAAQR
FT                   IVRLAAPYAPFSGDLADIDRLEIIRTWRFERGDRLSSK"
     gtgcgtcata gacttttccg ccccccatcg gcagacttcg ccccacgcca gccaccacga        60
     tccgcaatga acgccgccgt cctcaagtcc ccctccgccg ctgccggcgt ccgcccggcg       120
     gaccgtttgg gcttcaccct gttcatcgca gccatcctgc acgtcgcctt catcctcggg       180
     gtgggcttct ccatgcccgc gccgagccag atcagcaaga ccctggaaat caccctagcc       240
     accttcaaga gcgacaaggc gccggagaag gccgactacc tcgcgcagat gaaccagcag       300
     ggcagcggta ccctggagca caaggccgcg ccgaagacca ccgaggtcgc gccgttccag       360
     gacaaccagg tgaagaaagt cgcgccgccg gctacgccga agcaggccag gagcgaagag       420
     gcgcccaagg ccgcggtgac caccacccgc cagcgccagc agaaggcacc gagcaagacc       480
     caggcacaga aggccgagca ggtcgccaag ccggcgccgc atttcgactc aacccagctg       540
     tcggcggaaa tcgccagcct cgaggccgac ctggccaagg agcagcaggc ctacgccaag       600
     cgcccgcgca tccaccgcct gagcgccgcc tcgaccatgc gcgacaaggg cgcctggtac       660
     aaggaagact ggcgcaagaa gatcgaacgc atcggcaacc tcaactaccc cgacgaggcc       720
     cgccggcaga agctctacgg cagcctgcga ctgctggtgt cgatcaaccg cgacggcacc       780
     atctacgagg tgcaggtgct ggagtcttcc ggcgagccga tcctcgacca ggccgcccag       840
     cgcatcgtcc gcctggccgc gccctatgcg ccgttcagcg gcgacctggc cgacatcgac       900
     cggctggaga tcatccgtac ctggcgcttc gaacgcggcg accggctgtc cagcaagtag       960
//

If you have problems or comments...

PBIL Back to PBIL home page