(data stored in ACNUC7421 zone)

EMBL: CP000438.PE43

CP000438.PE43        Location/Qualifiers
FT   CDS_pept        54577..54699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJN0"
FT                   /protein_id="ABJ14999.1"
FT                   /translation="MVQRGHNRQVVFAEDEDYQRYLSDLRDLEDAFDNKLHAFC"
     atggtccagc ggggacacaa tcggcaagtg gtattcgccg aggacgagga ctaccagcgt        60
     tacctctccg atctacggga cctcgaggat gccttcgata acaagctcca tgcattttgc       120
     tga                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page