(data stored in ACNUC7421 zone)

EMBL: CP000438.PE437

CP000438.PE437       Location/Qualifiers
FT   CDS_pept        complement(479319..480734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL36"
FT                   /protein_id="ABJ15385.1"
FT                   /translation="MNTVAQPTSQRIARMDTPVTFDWKIRLPDVLGVLRRDYAGRFPQL
FT                   ASAALETLLERLRDDLPEDFLPALGQELESLGLALVERLDEDDSLNLYVVGATHSQRLL
FT                   DALAAQGHNARTLRQENAPEGARAALPAAAPAGLAPASAYICLEHAEHLAPGLAIARLP
FT                   GEDSRNLLDLRQWPRLQRLPDGAEETQGALLCRASSADGLHAWVRMTRSGSPYAWLHRS
FT                   RDLASLTPELPPLPLPPAQSLRQRRTPELAIGLAGDDLLLADRGLFFLYPGFAQGNDEP
FT                   RLLFEVPQARHSIENPPAVFTTPDQRVCLLSRGQFFEWREARIQPLPFPVGKDLPADPA
FT                   QPTSAAPGTIVWLERETLCEGRLDSGEIRSHSLDGLAEGPYLKLQALDGGWLLLAPWLE
FT                   PHRSRDLAQLWHLESGRALRIRYGELDLEGGLQHWAELPDGRIVVGDHARHVDLGRFES
FT                   LRQRLLRRRLAPA"
     gtgaataccg ttgcgcaacc cacttcgcaa cggatcgcac gcatggacac gcccgttacc        60
     ttcgattgga agatccgcct gcccgacgtg ctcggcgtac tccgccgaga ctatgccgga       120
     cgcttcccgc agttggcctc cgccgcactg gagacgctgc tggagcgcct gcgcgacgac       180
     cttcccgagg atttcctgcc agccctcggc caggagctgg aatccctcgg actggcgttg       240
     gtggaacgcc tggacgaaga cgacagcctg aacctgtacg tggtcggcgc cacccacagc       300
     cagcgcctcc tcgatgcgct cgcagcgcag ggccacaacg cccgcacgct gcgccaggaa       360
     aacgcccccg agggcgcccg ggcggccctc cccgccgccg cgccggccgg cctggcgccg       420
     gcttcggcct acatctgcct cgaacacgcc gagcacctgg cgcccggcct ggccatcgcc       480
     cgcctgccgg gcgaggacag ccgcaacctg ctggacctgc gccaatggcc caggctgcaa       540
     cgcctgcccg atggcgcgga ggaaacccag ggcgcgttgc tctgccgggc cagttcggcg       600
     gacggcctgc acgcctgggt caggatgacc cgttcgggaa gcccctacgc ctggctgcat       660
     cgctcccgcg acctcgcctc gttgacgccc gaactaccgc ccttgccgct gccgccggcg       720
     cagtcgttgc gccaacgccg caccccggaa cttgccatcg gcctggccgg ggacgacctg       780
     ctcctggccg accgcggcct gttcttcctc tatccgggct tcgcccaggg caacgacgaa       840
     ccacggttgc tcttcgaggt gccgcaagcg cggcactcca tcgagaatcc gccggcggtc       900
     ttcaccactc cggaccagcg cgtctgcctg ctctcccgcg ggcagttctt cgaatggcgc       960
     gaggcacgca tccagcccct gccgttcccc gtcggcaagg atctgcccgc cgatccggcg      1020
     caaccgacct cggcggcgcc cgggaccatc gtctggctgg agcgtgaaac gctctgcgaa      1080
     ggccggctcg acagcggcga gatccgcagc cactcgctgg acggcctggc cgaaggtccc      1140
     tacctgaagc tccaggccct ggacggaggc tggctgctcc tggcaccgtg gctggaaccg      1200
     catcgctcgc gggacctcgc ccagctctgg cacctcgaat ccggccgggc gctgcgcatc      1260
     cgctacggcg aactggacct ggagggcgga ctacagcact gggcggagct gcccgacggc      1320
     cggatcgtcg tcggcgacca tgcccggcat gtcgacctcg gcaggttcga aagcctgcgc      1380
     caacgcctgc tgcggcggcg cctggcgccg gcctga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page