(data stored in ACNUC7421 zone)

EMBL: CP000438.PE438

CP000438.PE438       Location/Qualifiers
FT   CDS_pept        complement(480769..481491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15386"
FT                   /db_xref="GOA:A0A0H2ZKX2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX2"
FT                   /protein_id="ABJ15386.1"
FT                   /translation="MRLSRFFVDQPLALGQHDLPETQAHYIGRVLRHATGDAVQLFDGS
FT                   GREYLGELVEVGKKNVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVA
FT                   EITPIVSERCEVRLKDERADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRD
FT                   DELRLVLHPVAAPLASHVPPSRLAFLVGPKGGLSDAEVEQAKAAGFHAARLGPRVLRTE
FT                   TAPVVALAVAQQLWGDFA"
     atgcgcctgt cccgcttctt cgtcgaccag cccctcgccc tcggccagca cgacctgccc        60
     gagacccagg cccactacat cggccgcgtg ctgcggcacg ccacgggcga cgccgtgcaa       120
     ctgttcgacg gcagcggccg ggaatacctc ggcgagctgg tcgaggtcgg caagaagaat       180
     gtccgcgtcg aactccgcga gcagttcgcc ggccagcccg actcgcccct gcgtatccac       240
     ctggggcaag gcctgtcgcg cggcgagcgg atggactggg cgatccagaa ggccaccgag       300
     ctgggggtgg cggaaatcac cccgatcgtc agcgagcgtt gcgaagtgcg cctgaaggac       360
     gagcgcgccg acaagcgcct gcaacactgg cgccaggtgg cgatcagcgc ctgcgagcag       420
     tgcggccgtt cgagcctgcc gctgatccat ccgccgctgg ccctggagga ctggctgcgc       480
     gggcgggacg atgagctcag gctggtcctg caccctgtgg ccgcccccct ggccagccat       540
     gtgccgccgt cgcgcctggc cttcctggtg ggtcccaaag gcggcctgag cgatgccgag       600
     gtggagcagg caaaggcggc cggcttccac gccgcgcgcc tcggcccgcg agtgctgcgc       660
     accgagaccg cgccggtggt agcgttggcg gtggcccagc aactctgggg cgacttcgcc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page