(data stored in ACNUC7421 zone)

EMBL: CP000438.PE44

CP000438.PE44        Location/Qualifiers
FT   CDS_pept        54909..55304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIY3"
FT                   /protein_id="ABJ15000.1"
FT                   /translation="MPVLALRLTALAALAISVSGCVMEAYGSRARSDAQSWIGLPIQDV
FT                   IKRFGEPERVTGDAARQKYVWKEYENYSHDYDYTYYEQGHGNTPNSSVLNQKTGTANQS
FT                   GYYTCIYEFFADASGRVVDATARGECR"
     atgccggtac tggctctgag actcaccgcc ctggcggccc ttgcgatcag cgtgtcgggg        60
     tgcgtcatgg aggcctatgg cagtcgcgcg cgtagcgatg cgcagtcctg gatcggcttg       120
     ccgatccagg acgtgatcaa gcgcttcggc gagccggaac gtgtgacggg ggatgccgcc       180
     aggcagaagt acgtgtggaa ggagtacgag aactatagcc acgactacga ctacacctac       240
     tacgagcagg gccatggcaa tacgcccaac agctcggtcc tgaaccagaa gaccggcacg       300
     gccaaccaga gcggctatta cacctgcatc tacgagttct ttgccgacgc ctcgggcagg       360
     gtggtcgatg cgaccgcgcg gggtgagtgc cgctag                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page