(data stored in ACNUC7421 zone)

EMBL: CP000438.PE448

CP000438.PE448       Location/Qualifiers
FT   CDS_pept        complement(494807..495877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL45"
FT                   /protein_id="ABJ15396.1"
FT                   /translation="MANSRKHLIYLVYGRQTYHQEALFSIASAFAHLRDGAAHGLTVRV
FT                   YTDDPSPYAGLPVQVREVTAEELVAWCQPHGYHFRAKHVALRDALEDADQALLIDTDTF
FT                   FHSSPLRLFDRIQPGSLLCNAIGARYGEHRNFPLYRDLSPYLFERGWADDEMHQLNSGV
FT                   IGLPREEAKILDRSLELMDELYPIANGAYTLEEFVLAVAAHKRLELVGCTDLIHHYWSR
FT                   KQLFRAKIQAWLCKHGSSLLSAAALDDTLKVTDRLPRPPRAKRLLYKLGTLPLPAPMRQ
FT                   FSIELLYGCHEYSNEFDRACGPVWWEKAATNAIERYPQEPIAEQIEDWLNHSLLRNLLG
FT                   SRANEIRQHLRQRDLL"
     atggccaact cacgcaagca tctgatctac ctggtctacg ggcgacagac ctaccaccag        60
     gaagccctgt tcagcatcgc cagcgccttc gcccacctcc gcgacggggc ggcgcatggc       120
     ctgacggtca gggtctatac cgacgacccc agtccctacg ccggcctgcc ggtgcaggtc       180
     cgcgaagtga cggccgagga gctggtcgcc tggtgccaac cgcacggcta tcacttccgc       240
     gccaagcacg tggccctgcg cgacgccctg gaagacgccg accaggcatt gctgatcgac       300
     accgatacct tcttccacag ttcgcccctg cgcctgttcg accgcatcca gcccggcagc       360
     ctgctgtgca acgcgatcgg cgcgcgctat ggcgaacacc gtaacttccc gctctaccgc       420
     gacctctcgc cctacctgtt cgagcgcggc tgggccgacg acgagatgca ccagctcaac       480
     tccggcgtca tcggcctgcc tcgggaagag gcgaaaatac tcgaccgttc gttggaatta       540
     atggatgaac tctatccaat tgccaacggt gcctatactc ttgaggaatt cgtcctggcc       600
     gtcgccgccc acaagcggct ggagctggtg ggttgtaccg acctgatcca ccattactgg       660
     agccggaaac agctgttccg cgcgaagatc caggcctggt tgtgcaagca cggttcctcc       720
     cttctcagcg ctgcagccct cgacgacacc ctcaaggtga ccgatcgact gccacgccca       780
     ccgcgtgcca agcgtctgct gtacaagctg ggaaccctgc cgttgccggc tccgatgcgc       840
     cagttcagta tcgaactgct ctacggttgc cacgaataca gtaacgagtt cgaccgggcc       900
     tgcggccccg tctggtggga gaaagccgcg accaatgcca tcgaacgcta tccgcaggaa       960
     ccgattgcgg aacaaatcga ggattggctg aatcacagct tgctgcgcaa cctccttggc      1020
     tcccgggcca acgagatccg ccagcatttg cgccagcgtg acctgctctg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page