(data stored in ACNUC7421 zone)

EMBL: CP000438.PE45

CP000438.PE45        Location/Qualifiers
FT   CDS_pept        complement(55575..56984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00550"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15001"
FT                   /db_xref="GOA:A0A0H2ZJW4"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJW4"
FT                   /protein_id="ABJ15001.1"
FT                   /translation="MRLHRGGEPDGYRRQRRPHGGRRTTVQAPRGRLLLWCAQARRHPL
FT                   SRRMESSMTLSLDLLLSLCTALAIGLLIGAERGWQERDHEDARQIAGIRTFSLAGLLGG
FT                   FATLLAGELGSAVWVALLLALAALAVAGYVSDVRRGGDQGMTTEIALLMTFLLGSLALT
FT                   EQRLLAAAGGIVLTLLLSLKDKLHALLKRLTAEELSGTLKLLFISVVLLPVLPNQGYGP
FT                   WAFFNPYLTWWMVVLIAALGFSAYLAIRLIGSRKGLLLTAVLGGLVSSTVMTLTLARLR
FT                   ERMPDALLACALLATSALMFPRILVEIGAIHPALLKELVLPFAATTLVYLGGTLFHALR
FT                   GGRASQEAPDEPGLRNPFELLPALRFAALLSAILLLVEVGRRLFGDAGIYAVALLSGLA
FT                   DVDAITLSLARAAQGELDPGVASRGIALAALSNSLVKAGLIVLVGGKRLALQTLPFSLA
FT                   GLLVGALLILL"
     gtgcgcctac accggggcgg agaacccgat ggataccggc ggcagcgccg gcctcatggc        60
     ggacggcgta ccaccgtgca ggcacctcgg ggtcgtctgc tgctatggtg cgcacaggca       120
     cgtcgccatc ctctctcccg gcgaatggaa tcgagcatga cgctttccct ggatctgttg       180
     ttgagcctgt gcacggccct ggccatcggc cttctgatcg gcgccgagcg cggctggcaa       240
     gagcgcgacc acgaagatgc gcggcagatc gccggaatcc gcaccttcag cctggccggc       300
     ctgctcggcg gcttcgccac cctgctcgcg ggcgaactgg gcagcgcagt ctgggtagcc       360
     ttgctgctgg ccctcgcggc gctggccgtg gccggctacg tgagcgacgt caggcgtggc       420
     ggcgaccagg gcatgaccac cgagatcgcc ctactgatga ccttcctcct cggcagcctc       480
     gccctcaccg aacagcgcct gctggctgcc gccggcggca tcgtgctgac cctgctgctg       540
     agcctcaagg acaagctcca cgccctgctg aagcgcctga ccgccgagga actgtcgggc       600
     accctcaagc tgctgttcat ctccgtggtc ctgctgccgg tgctgcccaa ccagggctac       660
     ggtccctggg cgttcttcaa tccctacctg acctggtgga tggtggtgct gatcgccgcc       720
     ctcggtttct ccgcctacct ggccatccgc ctgatcggct cgcgcaaggg cctgttgctg       780
     accgcggtgc tcggcggcct ggtgtcctcc acggtgatga ccctgaccct ggcgcgcctg       840
     cgcgagcgca tgcccgacgc cctgttggcg tgcgccctgc tggcgacctc ggcgctgatg       900
     ttcccgcgca tcctcgtcga gatcggcgcg atccacccgg ccttgctgaa ggaactggtc       960
     ctgccattcg ccgccaccac cctcgtctac cttggcggca cgctgttcca cgccctgcgc      1020
     ggcggccgcg ccagccagga ggcgcccgac gagccaggcc tgcgcaaccc cttcgaactg      1080
     ctcccggccc tgcgcttcgc cgccctgctg agcgcgatcc tgctgttggt ggaggtcggc      1140
     cggcggctgt tcggcgatgc cggcatctat gcggtcgcgc tgctctccgg cctcgccgac      1200
     gtcgacgcga tcaccctgtc cctggcccgc gcggcgcagg gcgaactcga tccaggcgtg      1260
     gccagccgcg gcatcgccct tgccgccctg agcaacagcc tggtcaaggc cggcctgatc      1320
     gtgctggtgg gcggcaagcg gctggccctg caaacgctac ccttcagcct ggcggggctg      1380
     ctggtaggag cgctgctgat cctgctgtga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page