(data stored in ACNUC7421 zone)

EMBL: CP000438.PE450

CP000438.PE450       Location/Qualifiers
FT   CDS_pept        complement(496862..497416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05600"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15398"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB9"
FT                   /protein_id="ABJ15398.1"
FT                   /translation="MSAPTMSTHLADRYNQAWLFAARAHRNQTLSGSPLPYLVHLGMVA
FT                   NELLAADRDGAIERLGETLQIAVLHDTLEDTATSPEELRQQFGEFVCAGVQALSKRVGD
FT                   GPKRSLDDYLQALAEGPAQYALVKLCDRITNLQPPPQTWSQDKIANYHQESQLILARLG
FT                   HAHAATARRLREKIEHYRQYY"
     atgagcgctc ccacgatgtc cacgcacctc gccgatcgct acaaccaggc ctggctgttc        60
     gccgcccgcg cccaccgcaa ccagaccctc agcggctcgc cgctgcctta tctggtgcac       120
     ctgggcatgg tcgccaacga gctgctggcc gccgatcgcg acggtgccat cgaacggctc       180
     ggggaaaccc tgcagatcgc ggtcctgcac gacaccctgg aagacacggc gacctcaccc       240
     gaggagctgc ggcaacagtt cggcgagttc gtctgtgccg gcgtgcaggc cctgagcaag       300
     cgcgtgggcg acggccccaa gcgttccctc gacgactatc tccaggcgct tgccgagggc       360
     ccggcgcagt acgccctggt caagctgtgc gaccgcatca ccaacctgca gccaccgccg       420
     cagacctgga gccaggacaa gatcgcgaac taccaccagg agtcgcagct gatcctcgct       480
     cgcctcggcc atgcccacgc cgcgacggcc cgacgcctgc gggaaaaaat cgagcactac       540
     cgccagtact actga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page