(data stored in ACNUC7421 zone)

EMBL: CP000438.PE452

CP000438.PE452       Location/Qualifiers
FT   CDS_pept        499155..499589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15400"
FT                   /db_xref="GOA:A0A0H2ZKK1"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK1"
FT                   /protein_id="ABJ15400.1"
FT                   /translation="MLECAVMRIAPISRSPLLQWLSFALCACVLVNALACGVLHLQALG
FT                   VGSDKGQKASVGLFCVAGASQWLSLDPDDGSAGDPVPVNPQLPVSCPMCSALVLFVALG
FT                   VIWSWRLQRRRQARFRPPATREPVPPRYVWPPANPRASPA"
     atgctagagt gcgcggtcat gagaatcgct cccatctccc gctcaccgct gttgcagtgg        60
     ctgagcttcg ccctctgtgc ctgcgtgctg gtcaacgcgc tggcttgcgg cgtcctgcac       120
     ctgcaggcgc tgggagtggg cagcgacaaa gggcagaagg ccagcgtcgg gctgttctgc       180
     gtcgccggtg ccagccaatg gctatccctg gatcccgacg acgggtccgc cggcgatccg       240
     gtaccggtca atccccagtt gccggtgagc tgcccgatgt gcagcgccct ggtgctgttc       300
     gtcgcgctcg gggtgatctg gtcctggcgc ttgcaacggc gacgccaggc gcgtttccgc       360
     ccgcccgcca cgcgcgagcc ggtgccgccc cggtacgtct ggccgccggc caacccgcgc       420
     gcttcccccg cctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page