(data stored in ACNUC7421 zone)

EMBL: CP000438.PE454

CP000438.PE454       Location/Qualifiers
FT   CDS_pept        501918..503396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05650"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15402"
FT                   /db_xref="GOA:A0A0H2ZL52"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL52"
FT                   /protein_id="ABJ15402.1"
FT                   /translation="MKRYLYLWHRWLGIGCCLLMVLWFVSGMVMLYVGYPKLTPLERLA
FT                   HLPELDGCEACVPLRTALAGGDGKTPRSIRLASVGGLPTYLLDDADGRTRALAARDGRP
FT                   LAVDADRVLASARAFSGEVPMQLQGRIEEDAWTHTRNLDPHRPLWRVQTADEEGRLLYL
FT                   SSQTGEVVRDASRRERAWNWLGAWLHWLYPLRGGWFDGQWANLVIGLSLLATLATVLGI
FT                   LVGLLRWRFRKPYRSGSRSPYAGGFQRWHHLAGLLFGALVLSWIFSGLMSMNPWNLFGR
FT                   GTPLDLAAYQGGSWDRALPAGLEADAVLRRLRAAGLRVRELEWRALDGEPYALGRSASG
FT                   NSLLLTADGEILRELPADRLLAAARALLPGVPMQAERLERYDFYYYPREEHSMMGYLER
FT                   RLPVWRLRFDDPRHTWVHLDPYSGAVVGVLDDGRRGSRWLFSLLHSWDWLPLLTRRPLW
FT                   DLWMLGFSLGGLVVCASGCWIGWRRLRGRRPKRR"
     atgaaacgct acctgtacct gtggcaccgc tggctgggca tcggctgctg cctgctgatg        60
     gtgctctggt tcgtctccgg catggtcatg ctgtatgtcg gctatcccaa gctgactccg       120
     ctggaacgcc tggcccacct gcccgagctg gacggctgcg aggcctgcgt accgctgcgg       180
     acggccctcg ccggcggcga tggaaagacc ccgcggagca tccggctggc cagcgtagga       240
     ggcctgccga cctacctgct ggacgatgcc gacggacgca cgcgtgcgct ggcggcgcgc       300
     gacggccgac cgctggcggt ggacgcggac agggtgctgg cttcggcccg tgctttcagc       360
     ggcgaagtac cgatgcagtt gcaagggcgg atcgaggaag acgcctggac ccatacccgc       420
     aacctcgatc cgcaccggcc gctatggcgg gtgcagaccg cggacgagga gggccggctg       480
     ctctacctgt cctcgcagac cggcgaggtg gtacgcgacg ccagccgccg ggagcgcgcc       540
     tggaactggc tcggcgcctg gctgcactgg ctctatccgc tgcgcggcgg ctggttcgac       600
     gggcagtggg cgaacctggt gatcggcctg tcgctgctgg cgaccctggc gaccgtcctc       660
     ggcatcctcg tcggcctgct ccgctggcgc ttccgcaagc cctaccgcag cggctcgcgc       720
     tcgccctatg cgggcggttt ccagcgctgg caccacctcg ccggcctgct cttcggcgcg       780
     ctggtgctga gctggatctt cagcgggctg atgtcgatga atccgtggaa cctgttcggc       840
     cgcggcacgc cgctcgacct cgcggcctac cagggcggta gctgggaccg ggcgctgccc       900
     gccggactgg aggcggacgc tgtcctgcgg cgcttgcgtg ccgccgggtt gcgggtgcgc       960
     gagctggagt ggcgggcgct cgacggcgag ccctatgcgc tcgggcgcag cgccagcggc      1020
     aacagcctgc tgctgacggc ggatggcgaa atcctccgcg agctacccgc ggatcgcctg      1080
     ctggcggcgg ctcgcgcgct gctgccgggc gtgccgatgc aggccgaacg gttggaacgc      1140
     tacgacttct attactaccc gcgcgaagaa cacagcatga tgggctacct ggagcggcgc      1200
     ctgccggtct ggcgcctgcg tttcgacgat ccccggcata cctgggtgca cctggatccc      1260
     tacagcggcg cggtggttgg cgtgctcgac gacggtcggc gcggcagccg ctggctgttt      1320
     tccctgttgc atagctggga ctggctgccg ctgctgaccc ggcgtccgct gtgggacctg      1380
     tggatgctcg gtttcagcct cggcggcctg gtggtctgcg ccagcggctg ctggatcggc      1440
     tggcgtcgcc tgcgcggccg ccgtccgaag cgtcgctga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page