(data stored in ACNUC7421 zone)

EMBL: CP000438.PE461

CP000438.PE461       Location/Qualifiers
FT   CDS_pept        complement(511113..511229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05775"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05775"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL41"
FT                   /protein_id="ABJ15640.1"
FT                   /translation="MVRTLTILVIFIFNYLKSISYKLKQPFENNLAQSMISI"
     atggttagaa ccctcaccat tttggtgata tttattttta attatttaaa atcaataagt        60
     tataaactca aacaaccatt tgaaaataat cttgctcaat cgatgatcag catctag          117
//

If you have problems or comments...

PBIL Back to PBIL home page