(data stored in ACNUC7421 zone)

EMBL: CP000438.PE467

CP000438.PE467       Location/Qualifiers
FT   CDS_pept        518460..518864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05860"
FT                   /product="putative long-chain acyl-CoA thioester hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05860"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15414"
FT                   /db_xref="GOA:A0A0H2ZLD3"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD3"
FT                   /protein_id="ABJ15414.1"
FT                   /translation="MNFHTRKWVKPEDLNPNGTLFGGSLLRWIDEEAAIYAIIQLGNQR
FT                   VVTKYISEINFVSSARQGDIIELGITATDFGRTSLTMTCHVRNKITRKSILTIDKMVFV
FT                   NLGPDGLPAPHGKTEITYIKDQFKEDEVLP"
     atgaatttcc acacccgcaa gtgggtcaag ccagaagatc tcaaccccaa cggcaccctg        60
     ttcggcggca gcctgctgcg ctggatcgac gaagaagcgg cgatctacgc gatcatccag       120
     ctgggcaacc agcgcgtggt caccaagtac atttccgaga tcaacttcgt cagctcggcg       180
     cgccagggcg acatcatcga gctgggcatc accgccaccg acttcggtcg tacctcgctg       240
     accatgacct gccacgtgcg caacaagatc acccgcaaga gcatcctcac catcgacaag       300
     atggtcttcg tcaacctcgg cccggacggc ctgccggcgc cccacggcaa gaccgagatc       360
     acctacatca aggaccagtt caaggaagac gaagtcctgc cctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page