(data stored in ACNUC7421 zone)

EMBL: CP000438.PE470

CP000438.PE470       Location/Qualifiers
FT   CDS_pept        522237..523031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05890"
FT                   /product="putative stomatin-like transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05890"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15417"
FT                   /db_xref="GOA:A0A0H2ZL69"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL69"
FT                   /protein_id="ABJ15417.1"
FT                   /translation="MMGISYGLAMLLVFLALLLFSALRILREYERGVVFQLGRFWKVKG
FT                   PGLVLVIPAIQQMVRIDLRTIVLDVPPQDVISRDNVSVKVNAVVYFRVLDPQKAIIQVE
FT                   NYLAATSQLAQTTLRAVLGKHELDEMLAERERLNLDIQQVLDAQTDAWGIKVANVEIKH
FT                   VDLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLGRQSGAMQLRYMQT
FT                   LGAIAGDKSSTIVFPMPIELFGGKYAGAAPRNEKAAGEDEER"
     atgatgggta tttcctatgg tttggcgatg ttgctggtgt tcctcgcgct gctgctgttc        60
     agcgcgctgc gcatcctccg cgagtacgag cgtggcgtgg tgttccagct cgggcggttc       120
     tggaaggtca aggggccggg gctggtgctg gtgatcccgg cgatccagca gatggtgcgc       180
     atcgacctgc gcaccatcgt cctcgacgtg ccgccgcagg atgtgatttc ccgcgacaac       240
     gtttcggtga aggtcaacgc ggtggtgtac ttccgcgtgc tcgatccgca gaaggcgatc       300
     atccaggtgg agaactacct ggccgccacc agccaattgg cgcagaccac cctgcgcgcg       360
     gtgctgggca agcacgaatt ggacgagatg ctcgccgagc gcgagcgcct gaacctggat       420
     atccagcagg tgctcgatgc gcagaccgac gcctggggca tcaaggtggc gaatgtggaa       480
     atcaagcacg tcgatctcaa cgaatcgatg gtccgcgcca tcgcccggca ggccgaggcg       540
     gagcgtgagc gcagggccaa ggtgatccat gccgagggcg agctgcaagc ctcggagaaa       600
     ctcatgcagg cggcgcagat gctcggccgg cagagtggcg ccatgcagtt gcgctacatg       660
     cagaccctcg gcgcgatcgc cggcgacaag agttcgacca tcgtcttccc gatgccgatc       720
     gaactcttcg gcggcaagta cgcaggtgcc gcgccgcgaa acgaaaaggc cgccggagag       780
     gacgaggaga ggtga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page