(data stored in ACNUC7421 zone)

EMBL: CP000438.PE475

CP000438.PE475       Location/Qualifiers
FT   CDS_pept        528414..528938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15422"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL74"
FT                   /protein_id="ABJ15422.1"
FT                   /translation="MKPVQSRRLAFAALLSLSFSSASCHAATEHWGWIEQSWLMPERMQ
FT                   AKAKLDTGALTSSLDARNIHRYKKDGERWVRFDVVLPTADSKAPVSVTFERKVLRLIKV
FT                   RGAGGSDSRPVVAMDICLGAKLLREQFSLRDRGNMNYPVLLGRRTLEHLGAVDVSRTFT
FT                   RKPTCSALAAQ"
     atgaagcctg tgcaatcccg tcgtctggcc ttcgccgcgc tgttgtcgct gtcgttctct        60
     tccgcgtcct gccatgccgc caccgagcac tggggctgga tcgagcagtc ctggctgatg       120
     cccgagcgca tgcaggccaa ggccaagctg gataccggcg cgctgacctc gtcgctggac       180
     gcgaggaata tccatcgcta caagaaggac ggcgagcgct gggtgcgctt cgatgtcgtg       240
     ctgcccaccg ccgacagcaa ggcgccggtc agcgtgacct tcgagcgcaa ggtgctgcgg       300
     ctgatcaagg tgcgcggcgc cggtggcagc gacagccgtc cggtggtggc gatggacatc       360
     tgcctgggcg ccaagctgct gcgcgagcag ttctccctgc gcgaccgcgg caacatgaac       420
     tatccggtgc tgctcggccg ccgcacgctc gaacacctcg gcgcggtcga cgtgtcccga       480
     acctttaccc gcaaacctac ctgcagcgcg ctcgccgctc agtag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page