(data stored in ACNUC7421 zone)

EMBL: CP000438.PE478

CP000438.PE478       Location/Qualifiers
FT   CDS_pept        533749..534327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15425"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM0"
FT                   /protein_id="ABJ15425.1"
FT                   /translation="MRVTTHATLAAALLLSAASAFAFNLGDAAKAVAGASQGDSAQVAT
FT                   TPQTSGLLGALTGQLGVSQEQAVGGTGALLGLAKNQLAGNDYSQLVKTIPGLDKLAGNN
FT                   ALAGLGGLGNVLGKSGGDSKGLGSLLGNADSMGDVNKAFGTLGMDSGMTEKFAQVLVDY
FT                   FGKQGANSELLGSLSNLWGVSKAGGSSLL"
     atgcgcgtca ccacccacgc taccctggcc gcggccctgc tgctcagcgc cgcctccgcg        60
     ttcgccttca atctcgggga tgccgccaag gcggtcgccg gggcgtccca gggcgactcc       120
     gcccaggtag ccactacccc gcagaccagc ggtctgctcg gcgcactcac cggccagctc       180
     ggggtcagcc aggagcaggc ggtcggcggt accggcgccc tgctcggcct ggccaagaac       240
     cagttggccg gcaacgatta ttcgcaactg gtgaagacca tccccggcct cgacaagctg       300
     gccggcaaca acgccctggc cggtctcggc gggctcggca acgtgctcgg caagagcggc       360
     ggcgacagca agggcctcgg ttcgctgctc ggcaatgcgg acagcatggg cgacgtgaac       420
     aaggccttcg gcaccctggg catggatagc gggatgaccg agaagttcgc ccaggtgctg       480
     gtcgactact tcggcaagca gggcgccaac agcgagctgc tgggcagcct gagcaatctc       540
     tggggagtga gcaaggcggg cggctcgtcg ctgctctga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page