(data stored in ACNUC7421 zone)

EMBL: CP000438.PE480

CP000438.PE480       Location/Qualifiers
FT   CDS_pept        535279..535983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15426"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK97"
FT                   /protein_id="ABJ15426.1"
FT                   /translation="MLRSSRRLLVRPVNSSRMVGFPVLGVGRRGPSYASAPRRPSRRRG
FT                   ERNRAVLVLCGPRITSGDARVKRALALLSLFALPVLAAEPNLYGRYEWVSLPELDRTLQ
FT                   AKMDTGAYTSSLSAKDIELFQRDGEEWVRFRLATKEADGSVFEHKLARIGKIKNRADNR
FT                   NGEDEDEDRLSERPVIDLQVCLGGAMKTIEVNLTDRSAFNYPFLMGTKGLRKFHVAVDP
FT                   SERFVADKPTCK"
     gtgttgagaa gcagcagaag gctgctggtc aggccggtca acagttcccg catggttggt        60
     ttccctgtcc tgggtgtggg tcgacgcggc ccatcatacg catccgcgcc gcgccgccca       120
     agccgccggc gtggcgaacg aaaccgcgcc gtgctagtcc tatgtggacc tcgtatcact       180
     tcaggagatg cccgcgtgaa gcgtgccctt gccttgctct cgctgttcgc cctgccggtc       240
     ctcgccgccg agcccaacct ctacggccgc tacgaatggg tctccctgcc ggagctggac       300
     cgcaccctgc aggcgaagat ggacaccggc gcctacacct cctcgctgtc ggccaaggac       360
     atcgagctgt tccagcgcga cggcgaggag tgggtgcgct tccgcctggc caccaaggag       420
     gccgacggct cggtgttcga gcacaagctg gcgcgcatcg gcaagatcaa gaaccgcgcc       480
     gacaaccgca acggcgagga cgaggatgag gaccgcctga gcgaacgccc ggtgatcgac       540
     ctgcaggtct gcctgggcgg agcgatgaag accatcgagg tcaacctcac cgaccgcagc       600
     gccttcaact atccgttcct gatgggcacc aagggcttgc gcaaattcca cgtcgcggtc       660
     gatccctccg agcgcttcgt cgccgacaag cccacctgca agtaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page