(data stored in ACNUC7421 zone)

EMBL: CP000438.PE484

CP000438.PE484       Location/Qualifiers
FT   CDS_pept        539691..539993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15431"
FT                   /db_xref="GOA:A0A0H2ZKA2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA2"
FT                   /protein_id="ABJ15431.1"
FT                   /translation="MRLFFEFTLCAALGLLVSGVILIFLLFFGKFGLIEYWIASGKPLA
FT                   HAMLVLMPDGFWEGLSGIEGAAGNPHVRSFLELCMGLGQSALLLGLLLFRLVCWK"
     atgcgcctgt tcttcgagtt caccctctgt gccgccctcg gcctgctggt cagcggcgtg        60
     atcctgatct ttctgctgtt cttcggcaag ttcggcctga tcgagtactg gatcgccagc       120
     ggcaagcccc tggcccacgc catgctggtg ctgatgccgg acggattctg ggaaggcctc       180
     agcggcatcg agggcgccgc cggcaatccg cacgtgcgct ccttcctgga gctttgcatg       240
     gggctcggac agagcgcgct gttgctgggc ctgctgctgt tccgcctggt gtgctggaaa       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page