(data stored in ACNUC7421 zone)

EMBL: CP000438.PE487

CP000438.PE487       Location/Qualifiers
FT   CDS_pept        541813..542670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15434"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLF5"
FT                   /protein_id="ABJ15434.1"
FT                   /translation="MATVEILGAECRAGGAVNDDALGCTAQAAWVIDGATSIGRSVLGV
FT                   ESDARWLAQAVDRHLRLLLEVEPEQSSETLLRRLLNDIQGDFRAQSGRDWHDLEDMPAA
FT                   CLSLLRIRGGEIELLNIGDSRILVEGADGQVRSFGDSALYELDRQSLAHFCRMREEHPQ
FT                   WDHAELFKASRPRVRQNRLLMNKPEGYWALDISDRWLGQVQRETLPLAALRSFVLMTDG
FT                   FDRLVEPFRRYTDEQLLRRLEDVGVSAMLDELREIEQGDDQALAFPRFKIHDDASALWG
FT                   RIAG"
     atggccacag tggaaatact cggggcggaa tgccgcgcgg ggggcgcggt gaacgacgat        60
     gcgctgggct gcacggcgca ggccgcctgg gtgatcgacg gtgccaccag catcggtcgc       120
     agcgtgctgg gcgtggaaag cgacgcgcgc tggctggccc aggcggtgga ccggcacctg       180
     cggttgctgc tggaagtcga gcccgagcaa tccagcgaga ccctgctgcg gcgcctgctc       240
     aacgatatcc agggcgactt ccgcgcccag agcggccgcg actggcacga cctcgaagac       300
     atgccggcgg cctgcctgag cctgctgcgg attcgcggcg gagaaatcga actgctcaac       360
     atcggcgaca gccggattct cgtcgaaggc gccgacggcc aggtacgcag cttcggcgat       420
     tcggccctgt acgaactgga ccggcaatcc ctggcgcatt tctgccggat gcgcgaggaa       480
     catccgcagt gggatcacgc cgaactgttc aaggccagcc gcccgcgcgt gcggcagaac       540
     cgcctgctga tgaacaagcc cgagggctac tgggcgctgg acatcagcga ccgctggctc       600
     ggccaggtgc agcgcgagac cttgccgctc gccgcgttgc gttccttcgt gctgatgacc       660
     gacggcttcg accggctggt cgagcctttc cgccgctata ccgacgaaca gttgctgcgg       720
     cgcctcgagg acgtcggagt gagcgccatg ctcgacgagt tgcgcgagat cgaacagggc       780
     gacgaccagg ccctggcttt cccgcgtttc aagatccacg acgacgccag cgcgctgtgg       840
     ggtcggatcg cggggtga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page