(data stored in ACNUC7421 zone)

EMBL: CP000438.PE499

CP000438.PE499       Location/Qualifiers
FT   CDS_pept        554467..554910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06280"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15446"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB8"
FT                   /protein_id="ABJ15446.1"
FT                   /translation="MNEPGSFIWTWYGQDEHRWVLLSAEAFLALDFLALDGAMQRETIG
FT                   SCPGCSTWSEKIVPLHEWLEGCPGHQAGNFRDALRRVWALCNELPEEALGCFDFDIYAH
FT                   PGWQAVRREAREALRQNGWDSIRSHAEELRDDCWERVHGYPKK"
     atgaacgagc cgggcagttt catctggacg tggtacgggc aggatgagca tcgatgggtc        60
     ctgctcagcg cagaggcgtt cctggcgctc gatttcctgg ctcttgacgg tgccatgcag       120
     agagagacca tcggcagttg cccgggctgc tctacctggt cggagaagat cgtgccgttg       180
     cacgagtggc tcgaaggctg tccgggtcac caggccggga attttcgcga tgccttgagg       240
     cgtgtctggg cgctgtgcaa cgagctgccc gaggaagcgc tgggctgctt cgacttcgac       300
     atctatgccc accccggatg gcaggcggta cgtcgagagg cccgggaggc gctgcggcag       360
     aacggttggg acagcatccg tagccacgcc gaggagctgc gcgacgactg ttgggagcgt       420
     gtgcatggct acccgaagaa atga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page