(data stored in ACNUC7421 zone)

EMBL: CP000438.PE502

CP000438.PE502       Location/Qualifiers
FT   CDS_pept        557917..558432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06310"
FT                   /product="putative ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15449"
FT                   /db_xref="GOA:A0A0H2ZL27"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL27"
FT                   /protein_id="ABJ15449.1"
FT                   /translation="MDHLVLTVIATDHPGLVERIAQCIASHGGNWLESRMSRMAGQFAG
FT                   ILRVAVPAEGYDELVEGLQGLSSHGIRVLLAESGIEPVCNWKPIHLDLVGNDRPGIVRD
FT                   ITRLLAEHGVNLESLSTEVRPAPMSSEPLFHADALLAVPLTLSLDTLRERLEDLADDLM
FT                   VELVLDAS"
     atggatcacc tggtcctgac cgtgatcgcc accgaccatc ccggcctggt cgagcgcatc        60
     gcccaatgca tcgcctccca cggcggcaac tggctggaaa gccgcatgtc gcggatggcc       120
     gggcagttcg ccgggatact gcgggtggcc gtgccggcgg aaggctacga cgaactggtg       180
     gaagggctac agggcctgtc cagccacggt atccgcgtgc tcctggcgga aagcgggatc       240
     gagccggtat gcaactggaa gcctatccac ctcgacctgg tgggcaacga ccgccccggt       300
     atcgtgcgtg acatcacccg gctgctggcc gagcatgggg tgaacctgga aagcctgtcc       360
     accgaagtgc gcccggcgcc gatgagcagc gaaccgctgt tccatgccga tgcgctgctg       420
     gcggtgccgc tgaccctgtc gctggacacc ctgcgcgagc gactggaaga cctggccgac       480
     gacctgatgg tggaattggt gctggacgcg tcctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page