(data stored in ACNUC7421 zone)

EMBL: CP000438.PE504

CP000438.PE504       Location/Qualifiers
FT   CDS_pept        complement(560220..561194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06330"
FT                   /product="putative putative homoserine kinase type II"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15451"
FT                   /db_xref="GOA:A0A0H2ZKP1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP1"
FT                   /protein_id="ABJ15451.1"
FT                   /translation="MSHPFDQLTPDLVLDAVESLGYLSDARVLALNSYENRVYQVGIED
FT                   GEPLIAKFYRPDRWSDAAIREEHAFSAELAECEVPVVAPLSRDGESLFAFAGFRFALFP
FT                   RRGGRAPEPGNLDQLYRLGQLLGRLHAVGATRPFEHREALAVDNFGHASLATLLEGNFI
FT                   PRSLLPAYESVARDLLKRLDALFAEVPYQPIRLHGDCHPGNLLCRDEVYHMVDLDDCRM
FT                   GPALQDLWMMLAGERHERLAQIAELVDGYNEFHDFDPRQLPLLEGLRSLRLMHYSAWLA
FT                   RRWDDPAFPPSFPWFGSERYWGEQVLVLREQLAALDEEPLRLF"
     atgtcccatc ccttcgacca actgaccccc gacctcgtcc tggatgccgt ggaaagcctc        60
     ggctatctca gcgacgcacg ggtgctggcg ctcaacagct acgaaaaccg cgtgtaccag       120
     gtcggcatcg aggacggcga gccgctgatc gccaagttct accgaccgga ccgctggagc       180
     gacgcggcga tccgcgagga gcacgccttc tccgccgagc tggcggaatg cgaggtgccg       240
     gtggtggcgc cgctgtcgcg cgacggcgaa agcctgttcg cattcgccgg cttccgcttc       300
     gccctgttcc cccggcgcgg cgggcgcgcg cccgagccgg gcaatctcga ccagctctac       360
     cgcctcggcc agttgctcgg ccgcctgcac gcggtcggcg ccacgcggcc gttcgagcac       420
     cgcgaggcgc tcgctgtgga taacttcggc cacgcctcgc tggccaccct gctggaaggc       480
     aatttcatcc ccaggagcct gctgccggcc tacgagtcgg tcgcccgcga cctgctgaaa       540
     cgcctcgacg ccctgttcgc cgaggtgccc taccagccga tccgcctgca cggcgactgc       600
     catccgggca acctgctgtg ccgcgacgag gtctaccaca tggtcgatct cgacgactgc       660
     cgcatgggcc cggccctcca ggacctgtgg atgatgctcg ccggcgagcg ccacgaacgc       720
     ctggcgcaga ttgccgaact ggtcgacggc tacaatgagt tccacgactt cgacccgcgc       780
     cagctaccgc tgctcgaagg cctgcgcagc ctccgcctga tgcactacag cgcctggctc       840
     gcgcggcgct gggacgaccc ggcgttccca ccgagcttcc cctggttcgg cagtgaacgt       900
     tactggggcg agcaggtgct ggtgctgcgc gaacaactgg cggcgctgga cgaggaaccg       960
     ctgcggctgt tctga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page