(data stored in ACNUC7421 zone)

EMBL: CP000438.PE508

CP000438.PE508       Location/Qualifiers
FT   CDS_pept        complement(563308..563601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15455"
FT                   /db_xref="GOA:A0A0H2ZLH5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH5"
FT                   /protein_id="ABJ15455.1"
FT                   /translation="MGTEGFFDGLGEMLGRAIRFVVDLLSGLLGGIWGAMDDFLHGLAR
FT                   AIGMDASLFSFVFLVLGLLLLYSGIRAFMRRSIVGGVIWTVLGLIVMSWLIH"
     atgggtacag aaggcttttt cgacggactg ggcgagatgc tgggcagggc gatccgcttc        60
     gtggtggacc tgctctccgg cctgctgggc ggcatctggg gcgccatgga cgacttcctc       120
     cacggcctgg ccagggccat cggcatggac gcatcgctgt tcagcttcgt cttcctggtg       180
     ctcggcctgt tgctgctcta cagcggcata cgcgccttca tgcgccgctc gatagtcggc       240
     ggggtgatct ggacggtgct cggcctgatc gtcatgagct ggctcatcca ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page