(data stored in ACNUC7421 zone)

EMBL: CP000438.PE51

CP000438.PE51        Location/Qualifiers
FT   CDS_pept        complement(61430..63091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15007"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK06"
FT                   /protein_id="ABJ15007.1"
FT                   /translation="MRYARHASRYSLFTLAVSAALLPGAGWAANGDLAGARKPPSVACS
FT                   WNREAALSYEERRLDTPLPFSGANVVTHDQTPLAERIVKGAGFDGFEPAFAKRLCAADG
FT                   RTPVTSYAKALKLVTEEGRALWRAAVDRAQGRRAIPAGALPASDDRMLYWTRLYMTRTL
FT                   RQWAPSFRLGKAQAQALQWRFERASRGQLDIDLPRRYAADGSRYRRMIISGFDVFTLGT
FT                   PGTANTGLRNGNPSGATALALDGREFRLADGSLLRIEAYLLPVSYDPFNRGMQEDTLGP
FT                   WFRPGPRRVDASVTISQGGANQFWLEAWNGRFHGSSAGNDGIVYCPADSALPNYVLPLG
FT                   SVTNPGTAPISLRGSGCNINPPRRWLGYDSASRWRQNLPAQFSKASLPVRQLLAADTWR
FT                   GIERPPGATSQAAEGFDVTWHTNYDFFPDCANPRTENVPTNGVMNAMPDPSLVLPPNRR
FT                   ICARNGGGGDYLSNESAYRNTVLRDAFRLEIPAGHIHVPVMNNYYTGVPASGGGARNDN
FT                   AISDARYEAYRSAIVAQTRALLVGVGNALAQGAQAD"
     atgcgctacg cccgtcacgc aagccgatac tccctcttca ccctggccgt ctcggcagcc        60
     ctgctgcccg gcgccggctg ggccgccaac ggcgacctcg ccggcgcccg caagccgccc       120
     agcgtcgcct gctcctggaa ccgcgaggca gcgttgtcct acgaggagcg ccggctcgac       180
     acgccgctgc cgttcagcgg cgccaacgtc gtcacccacg accagacgcc gctggccgag       240
     cgcatcgtca agggcgccgg cttcgacggc ttcgaaccgg ccttcgccaa gcgcctgtgc       300
     gccgccgacg gccgcacccc ggtcaccagc tacgccaagg cactgaagct ggtcaccgaa       360
     gagggccgcg cgctgtggcg cgccgccgtc gaccgggccc aggggcgccg tgccattccc       420
     gccggcgcgc tgccggccag cgatgaccgc atgctctact ggacgcgcct ctacatgacc       480
     cgcaccctgc gccaatgggc gccctccttc cgcctcggca aggcccaggc ccaggcgctg       540
     caatggcgct tcgaacgcgc ctcgcgcgga cagttggaca tcgacctgcc gcgccgctac       600
     gccgccgacg gctcgcgcta ccggcggatg atcatcagcg gcttcgacgt cttcaccctg       660
     ggcactcccg ggacggcgaa caccggcctg cgcaacggca acccctcggg cgccaccgcc       720
     cttgcgctgg acggccgcga gttcaggctg gccgacggca gcctgctgcg tatcgaggcc       780
     tacctgttgc cggtcagcta cgacccgttc aaccgcggca tgcaggaaga caccctgggc       840
     ccctggttcc gccccggccc gcgccgggtc gacgcctccg tcaccatcag ccagggcggc       900
     gccaaccagt tctggctgga ggcctggaac ggccgcttcc acggctcctc cgccggcaac       960
     gacggcatcg tctactgccc cgccgacagc gctttgccca actacgtgct tcccctgggc      1020
     agcgtgacca atcccggcac cgcgccgatt tccctgcgcg gctccggctg caatatcaac      1080
     ccgccgcgcc gctggctcgg ctacgacagc gccagccgct ggcggcagaa cctgccggcg      1140
     cagttctcca aggcctcgct gccggtccgc cagttgctcg ccgccgatac ctggcgcggc      1200
     atcgagcggc cgccgggcgc taccagccag gccgcggaag gcttcgacgt cacctggcac      1260
     accaactacg acttcttccc cgattgcgcc aacccgcgca ccgaaaacgt gccgaccaac      1320
     ggggtgatga acgccatgcc cgatccctcc ctggtgctcc cgccgaaccg acggatctgc      1380
     gcgcgcaacg gcggtggcgg cgactacctg tccaacgaga gcgcctaccg caacacggtg      1440
     ctgcgcgacg cgttccgcct ggagattccc gccgggcaca tccatgtccc ggtgatgaac      1500
     aactactaca ccggcgtacc ggcgagcggc ggcggcgcgc gcaacgacaa cgccatcagc      1560
     gacgcccgct acgaggccta ccgcagcgcc atcgtggcgc agacccgggc gctgctggtg      1620
     ggcgtcggca acgccctggc gcagggggcg caagcggact ag                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page