(data stored in ACNUC7421 zone)

EMBL: CP000438.PE510

CP000438.PE510       Location/Qualifiers
FT   CDS_pept        564699..565457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06420"
FT                   /product="putative lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15457"
FT                   /db_xref="GOA:A0A0H2ZKC5"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC5"
FT                   /protein_id="ABJ15457.1"
FT                   /translation="MTEVDFNSDMGEGFGPWTIGDGVDAAIMPLISSANIATGFHAGDP
FT                   SSMRRTVEMAAEHGVAIGAHPGFRDLVGFGRRHIAAPAIELVNDMLYQLGALREFARLQ
FT                   GLSLQHVKPHGALYMHLARDEAAARLFVETLQRLEPELLLYCMPGSATWRIGRELGQPL
FT                   VREFYADRDYDRSGSIVFTRRVAALDPQQVADKVLRACREGKVRTVEGEDLDIAFDSVC
FT                   IHSDTPGALELVASTRARLEGAGIRIKAPR"
     atgactgaag tcgacttcaa ttccgacatg ggcgaaggct tcggcccatg gaccatcggc        60
     gatggcgtgg atgccgcgat catgccgctg atcagcagcg ccaacatcgc caccggtttc       120
     catgccggcg acccgagcag catgcgccgc accgtggaga tggccgccga gcatggcgtg       180
     gccatcggcg cccatccggg cttccgcgac ctggtcggct tcggtcgccg gcacatcgcc       240
     gcgccggcca tcgagctggt caacgacatg ctctaccagc ttggcgccct gcgcgaattc       300
     gcccggctgc agggcctgtc gctgcaacac gtcaagcccc acggcgcgct ctacatgcac       360
     ctggcgcgcg acgaggccgc cgcgcgcctg ttcgtcgaga ccctgcaacg cctggaaccg       420
     gaactgctgc tctattgcat gcccggttcg gccacctggc gcatcggtcg ggaactgggc       480
     cagccgctgg tgcgcgagtt ctacgccgac cgcgactacg accgtagcgg ctccatcgtc       540
     ttcacccggc gggtcgccgc cctcgatccg caacaggtcg ccgacaaggt cctgcgcgcc       600
     tgccgcgagg gcaaggtgcg caccgtcgag ggcgaggacc tcgacatcgc cttcgactcg       660
     gtgtgcatcc acagcgacac ccccggcgcc ctggagctgg tcgccagcac ccgcgcgcgc       720
     ctggaaggcg ccggcatccg catcaaggcg ccgcgttga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page