(data stored in ACNUC7421 zone)

EMBL: CP000438.PE511

CP000438.PE511       Location/Qualifiers
FT   CDS_pept        565534..565782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06430"
FT                   /product="putative biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15458"
FT                   /db_xref="GOA:A0A0H2ZLB5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB5"
FT                   /protein_id="ABJ15458.1"
FT                   /translation="MAEHNVQSPLPGTFYRKASPDAPPYAEVGQAVEAGSVIGLIEVMK
FT                   QFSEVQAGQAGILQAFHVEDGEAIEPGQVLAVIASAT"
     atggccgaac ataacgtgca gtcccccttg cccggcacct tctatcgcaa ggccagcccc        60
     gacgcgccac cctacgcgga ggtcgggcag gcggtcgagg ccggcagcgt gatcgggctg       120
     atcgaggtga tgaagcagtt ttccgaagtg caggccgggc aggccggcat actccaggcg       180
     ttccacgtgg aagatggcga ggccatcgag ccgggacagg tgctggcggt gatcgccagc       240
     gctacctga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page