(data stored in ACNUC7421 zone)

EMBL: CP000438.PE52

CP000438.PE52        Location/Qualifiers
FT   CDS_pept        63701..63841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK54"
FT                   /protein_id="ABJ15008.1"
FT                   /translation="MKRKMLAASLLLWMFSLTAQADCAVLGPGEDPCAGPVLGPTVCEC
FT                   P"
     atgaaaagga agatgctggc ggcttcgctg ctgctgtgga tgttctcgct cacggcgcag        60
     gcggactgcg cggtgctcgg gccgggggaa gatccctgcg cgggcccggt gctgggaccg       120
     accgtctgcg agtgcccgtg a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page