(data stored in ACNUC7421 zone)

EMBL: CP000438.PE520

CP000438.PE520       Location/Qualifiers
FT   CDS_pept        574317..574547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL39"
FT                   /protein_id="ABJ15467.1"
FT                   /translation="MEISGNAFVSGLNAVQSGSARVAQAGSEIARNTVEARSPQAEQMV
FT                   ELTRGKLEAQSGARVIEVADETLGTLIDTHA"
     gtggaaattt ccggcaacgc tttcgtcagt ggcctcaatg cggtgcagtc gggtagcgcc        60
     cgcgtcgccc aggccggcag cgagatcgcc cgcaacaccg tggaggcccg ttcgccccag       120
     gccgagcaga tggtcgagct gacccgcggc aagctcgagg cgcagagcgg cgcccgggtc       180
     atcgaggtag ccgacgagac cctcggcacc ctgatcgaca cccacgcctg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page