(data stored in ACNUC7421 zone)

EMBL: CP000438.PE537

CP000438.PE537       Location/Qualifiers
FT   CDS_pept        591645..591902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15484"
FT                   /db_xref="GOA:A0A0H2ZKR8"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR8"
FT                   /protein_id="ABJ15484.1"
FT                   /translation="MRTLTLCWLALLALAVAGVLLGGAGDSPWLLAAVLACAVAKGWLI
FT                   GERFMELAHAPALWRRLLLAWPLLMALAVGAALYLARMNN"
     atgcgaaccc tgaccctctg ctggctggcg ttgctggcgc tggccgtggc cggtgtgctg        60
     ctgggcggcg ccggcgactc tccctggctg ctggcggcgg tgctggcctg cgcggtggcc       120
     aagggctggc tgatcggcga gcgcttcatg gagctggccc atgccccggc gctatggcgc       180
     cgcctgctgc tggcctggcc gctgctgatg gccctggcgg tgggcgctgc gctgtacctg       240
     gcgcggatga ataactga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page