(data stored in ACNUC7421 zone)

EMBL: CP000438.PE54

CP000438.PE54        Location/Qualifiers
FT   CDS_pept        complement(66550..66978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15010"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIZ5"
FT                   /protein_id="ABJ15010.1"
FT                   /translation="MDLRPSHVHVFPPSRDLPAATSPHRETLLRSGCAWNGSLYLGYPL
FT                   GQPQLTVQRLSLAAHERLDWQVHPMPSALYVLKGELRLETRDGAQSTRVLEGEAAGCLM
FT                   NIIHRLIAGAEPVEALLFHAGVEGMPVGLGERGEMPDA"
     atggaccttc gccccagcca cgtgcatgtg ttcccaccca gccgcgacct cccggccgca        60
     accagtccgc accgcgaaac cctgctgcgc agcggctgcg cctggaacgg ctcgctctac       120
     ctcggctatc ccctcggcca gccgcagctc accgtgcagc gcctgagcct ggccgcccac       180
     gaacgcctgg actggcaggt ccatccgatg cccagcgcgc tttacgtgct caagggcgaa       240
     ctgcgcctgg agacccgcga cggagcccag agcacgcggg tgctggaagg cgaggcggcg       300
     ggttgcctga tgaacatcat ccatcgcctg atagccgggg ccgaaccggt ggaagccctg       360
     ctgttccatg ccggcgtgga aggcatgccg gtggggctcg gcgaacgcgg cgaaatgccc       420
     gacgcctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page