(data stored in ACNUC7421 zone)

EMBL: CP000438.PE548

CP000438.PE548       Location/Qualifiers
FT   CDS_pept        complement(600869..601375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15495"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF9"
FT                   /protein_id="ABJ15495.1"
FT                   /translation="MPARPDRARVTIALAVLVHLHRETIAEAPLPWRYRKQCPGGKPRR
FT                   RAGREATPPLGPEVVDASTRLALHEKKAPSPCMSDAMSKNKHPDLGEIQRSLNQALEGY
FT                   DCQCRMHYDGTVSINVAAREHDETFTFVGIQPGELDNPTRLHLFAESLRRDLALLEPWL
FT                   GKHAA"
     atgcccgccc gccctgaccg cgcacgcgtg acgattgcac tagcggtgct agtgcatttg        60
     catcgcgaaa cgatagcgga ggcaccccta ccctggcgat acaggaagca atgtccgggc       120
     gggaagccca gacgccgcgc cggccgggag gctacgccgc ccctcggtcc cgaggtcgtc       180
     gacgcatcca cccgactcgc cctgcacgag aagaaagccc catccccttg catgagcgat       240
     gcgatgagca agaacaagca ccccgatctc ggcgagatcc agcgcagcct gaaccaggcg       300
     ctggaaggct acgactgcca gtgccggatg cactacgacg gcaccgtcag catcaatgtc       360
     gccgcccgag agcacgacga aaccttcacc ttcgtcggca tccagcccgg cgagctggac       420
     aaccccaccc gcctgcacct gttcgccgaa agcctgcgtc gcgacctggc actactggag       480
     ccctggttgg gaaagcacgc agcctag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page