(data stored in ACNUC7421 zone)

EMBL: CP000438.PE553

CP000438.PE553       Location/Qualifiers
FT   CDS_pept        complement(606248..606856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06990"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06990"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15500"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG2"
FT                   /protein_id="ABJ15500.1"
FT                   /translation="MPRFLRNALLPVLALLLSGCGYNAMQAGDEQVKAAWSEVLNQYQR
FT                   RADLVPNLVSTVKGYASHEASVLTQVTEARAKVGSVQLNADQLDDEQAVQRFQKAQGEL
FT                   SSALSRLLVVTENYPQLKADGLFKDLLTQLEGTENRIAVARGRYVKSVQEYNVLLRQFP
FT                   GVITAKLFGYKPKANFSVENEAAISTAPKVDFGNPQPAQ"
     atgcctcgat tcctcagaaa tgccctcctt cccgtcctcg ccctgctgct cagcggctgc        60
     ggctacaacg ccatgcaggc cggcgacgaa caggtgaaag ccgcctggtc ggaagtgctc       120
     aaccagtacc agcggcgcgc cgacctggta cccaacctgg tcagcacggt gaagggctat       180
     gcctcccatg aggcgtcggt cctgacccag gtcaccgagg cccgggccaa ggtcggcagc       240
     gtgcagctga acgccgacca actggacgac gagcaggccg tgcagcgctt ccagaaggcc       300
     cagggcgaac tgagctcggc gctttcgcgc ctgctggtag tcaccgagaa ctacccgcaa       360
     ctgaaggccg acggcctgtt caaggacctg ctgacccaac tggaaggcac cgagaaccgc       420
     atcgccgtcg ctcgcggccg ctacgtcaag tcggtacagg aatacaacgt gctgctgcgc       480
     cagttccccg gcgtgatcac cgccaagctg ttcggctaca agcccaaggc gaacttcagc       540
     gtggaaaacg aagcggccat ctccaccgcg ccgaaagtcg atttcggcaa cccgcaaccg       600
     gcgcagtaa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page