(data stored in ACNUC7421 zone)

EMBL: CP000438.PE555

CP000438.PE555       Location/Qualifiers
FT   CDS_pept        607682..608512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07010"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15502"
FT                   /db_xref="GOA:A0A0H2ZLF7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLF7"
FT                   /protein_id="ABJ15502.1"
FT                   /translation="MLATSLVLCAAVLHATWNTLVKFSSDRLLVVACMDVVGVLCAILL
FT                   LPFVSLPPAEVWPWLLGATVLQLLYRVLLIEAYKVGDLGLVYPLMRGLSPLVVLGLTLA
FT                   FGGEQLSGRQILGILLIPFGMLCLLWGGGGSRLPWRTLPVVLLIGLCIGGYTWSDGNAL
FT                   KRWPLALDYLVWLTLLSGLPFPLIAAGARTRAFARFWALEWKLGLAVGVCVLASYGLVL
FT                   WAMQLGSIAEAAALRETSVLLAVLFGMRFLNEPFGLPRLLACGLVLAGMLLMKL"
     atgctagcca ccagcctggt gctgtgcgcc gccgttctcc acgccacctg gaacaccctg        60
     gtcaagttca gcagcgaccg cttgctggtc gtcgcttgca tggacgtggt cggcgtgctc       120
     tgcgccatcc tgctgttgcc cttcgtcagc ctgccgccgg ccgaagtctg gccctggctg       180
     ctcggcgcca ccgtcctgca actgctctac cgggtactgc tgatcgaggc ctacaaggtc       240
     ggcgacctgg gcctggtcta tccgctgatg cgcgggctgt cgccgctggt ggtgctgggc       300
     ctgaccctgg cgttcggcgg cgagcagctc agcggccggc agatcctcgg catcctgttg       360
     atccccttcg gcatgctttg cctgctctgg ggcggcggcg gttcgcgcct gccctggcgg       420
     actctgccgg tggtgctgct gatcggcctg tgcatcggcg gatacacctg gagcgacggc       480
     aacgccctga agcgctggcc gttggcgctg gactacctgg tctggctgac gctgctctcc       540
     ggcctgccgt tcccgctgat cgccgccggc gcgcgaaccc gcgccttcgc ccgcttctgg       600
     gcgctggagt ggaagctcgg cctggcggtc ggggtctgcg tgctggccag ctacggcctg       660
     gtgctgtggg ccatgcagct ggggtcgatc gccgaagcgg cggcgttgcg cgagaccagc       720
     gtgctgttgg cggtgctgtt cggcatgcgc ttcctcaacg agccgttcgg actgccgcgc       780
     ctgctggcgt gcggcctggt gctggccgga atgctgctga tgaaactctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page