(data stored in ACNUC7421 zone)

EMBL: CP000438.PE556

CP000438.PE556       Location/Qualifiers
FT   CDS_pept        608582..608968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07020"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15503"
FT                   /db_xref="GOA:A0A0H2ZL70"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL70"
FT                   /protein_id="ABJ15503.1"
FT                   /translation="MTIAFWCVLIAIFLPYVCTSIAKFGGEGYGGRANADPRAFLGSLE
FT                   GFRRRANNAQLNAFEVTPAFAAAVIIAHLVGNASQATLDSLAIAWITSRLLYVICYLAD
FT                   WGPLRSLVWFVGMLLIAAFFVVSA"
     atgaccatcg ctttctggtg cgtgctgatc gcgatcttcc tgccttacgt ctgtacctcc        60
     atcgccaagt tcggcgggga gggctacggc ggtcgggcca acgccgaccc gcgggcgttc       120
     ctcggttcgc tcgaaggctt ccgccggcgt gccaacaacg cccagttgaa cgccttcgag       180
     gtgaccccgg cgttcgccgc ggcggtgatc atcgcccatc tggtcggcaa cgcttcgcag       240
     gcgaccctgg atagcctggc cattgcctgg atcaccagtc gcctgctcta cgtcatctgc       300
     tacctcgccg actgggggcc gttgcgctcg ctggtctggt tcgtcggcat gctgctcatc       360
     gccgcgttct tcgtggtttc cgcctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page