(data stored in ACNUC7421 zone)

EMBL: CP000438.PE560

CP000438.PE560       Location/Qualifiers
FT   CDS_pept        complement(611373..612116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15507"
FT                   /db_xref="GOA:A0A0H2ZLG2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLG2"
FT                   /protein_id="ABJ15507.1"
FT                   /translation="MKIRLLSDLHHEHFDGRRQLPEVEADVVVLAGDIHSHLEGLHWAR
FT                   ETFADSEIVYVAGNHEFYSSEMTDLTQAMRNIARALDIHFLENDEARIGPARFLGATLW
FT                   TDFQLYGADGYAPAHELALQSMPDFSCIDWFGGDFTPEQSIALHRASRDWLAEQLARPH
FT                   DGPTLVVSHHAPSALSIPPQFVGNPLSPAFASNLDELLAQADYWLHGHVHDALDYRIGR
FT                   ARVLANPGGYPHERGGFRPEFVFEV"
     atgaagatcc gcctgctgtc cgacctccac cacgaacatt tcgacgggcg acgccaactg        60
     ccagaggtcg aggccgacgt ggtggtgctg gccggcgata tccacagcca cctggaaggc       120
     ctgcactggg cccgcgagac cttcgccgac agcgagatcg tctacgtcgc cggcaaccat       180
     gagttctact cctcggaaat gaccgacctg acccaggcga tgcgcaatat cgcccgggcg       240
     ctggatatcc acttcctgga aaacgacgaa gcgcggatcg gcccggcgcg cttcctcggc       300
     gccaccctgt ggaccgactt ccagctctat ggcgcggacg gctatgcgcc cgcccatgag       360
     ctggccctgc aatcgatgcc ggacttcagc tgcatcgact ggttcggcgg cgacttcacc       420
     cccgagcaga gcatcgccct gcaccgagcc tcgcgcgact ggctcgccga acagctggcg       480
     cggccccacg acggcccgac gctggtggtc agccaccacg cgcccagtgc gctgtcgatc       540
     ccgccgcagt tcgtcggcaa cccgctgtcg ccagccttcg cttccaacct cgacgaactg       600
     ctggcgcagg ccgactactg gctgcacggt cacgtccacg atgccctcga ctaccgcatc       660
     ggccgggcac gggtgctggc caatccgggc ggctatcccc acgagagagg cgggttccgt       720
     ccggaattcg tcttcgaggt ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page