(data stored in ACNUC7421 zone)

EMBL: CP000438.PE565

CP000438.PE565       Location/Qualifiers
FT   CDS_pept        618132..619196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15512"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG9"
FT                   /protein_id="ABJ15512.1"
FT                   /translation="MHTLYWRDLESPANGEWLGLAVQVEGAHRAPSFLHLQSGGQARIR
FT                   LMRGDQPLLWATQLPYHDGIWLVKSLVAASPAQASVPPIDSPTLEALRGLRGEARYKAW
FT                   SRYFVEALRASPGSCLEAGRWLLRLSLAEQAPAWQPPQSHDSRERVLERWRYRSVGRDA
FT                   LLPDWRFYSLEKVLDDDWVQWLDWWGRDNDALIALRRVEDDEGRVKWWRKKAREGELPP
FT                   VLALRLNCLDACVILDGHCRLRAGLLENVAPEILVLCAYDEQPMPVDTAQRERVLQSLA
FT                   QRVDAPVRRGRRPLDSEQLNQVLLRLFDDRPWPRVLTRARAVLKEEQWCAEVRDWLTAR
FT                   ERLDALEPIIRRVE"
     atgcacacgc tctactggcg ggacctcgaa agccccgcca atggcgaatg gctgggcctc        60
     gcggtccagg tggagggcgc ccatcgggcg ccctctttcc ttcatctgca atccggcggc       120
     caggcccgca ttcgcctgat gcgtggcgat cagccgctgc tctgggccac ccagttgccg       180
     taccacgatg gcatctggct ggtgaagagc ctggtcgcgg cgagcccggc gcaggccagc       240
     gtgccgccca tcgactcgcc gaccctggaa gccttgcgcg gcctgcgcgg cgaggcccgc       300
     tacaaggcct ggagccgcta tttcgtcgag gccctgcgtg ccagcccggg cagttgcctg       360
     gaggccgggc gctggttgct gcgcctgtcg ctcgccgagc aggcgcccgc ctggcagccg       420
     ccgcagagcc acgattcgcg cgaacgggtg ctggaacgct ggcgctaccg cagcgtcggg       480
     cgcgatgctc tgttgccgga ctggcgcttc tatagcctgg agaaggtcct cgacgacgac       540
     tgggtgcagt ggctcgactg gtgggggcgc gacaacgacg ccctgatcgc cctgcgccgg       600
     gtcgaggatg acgaggggcg ggtcaagtgg tggcgcaaga aggcccgcga aggcgagctg       660
     ccgccggtgc tggcgctgcg cctgaactgc ctggatgcct gcgtgatcct cgacggccac       720
     tgccggctgc gcgccggcct gctggagaac gtcgcgccgg agatcctggt gctctgcgcc       780
     tacgacgagc agccgatgcc ggtggatacg gcgcagcgcg aacgggtgct gcaatcgctg       840
     gcgcagcggg tcgacgcgcc ggtgcgccgt ggacgtcggc cgctggatag cgaacagctc       900
     aaccaggtgc tgctgcgcct gttcgacgac cgtccctggc cgcgagtgct gacccgtgcc       960
     cgcgcggtgc tgaaggaaga gcagtggtgc gcggaagtgc gcgactggct gaccgcccgc      1020
     gagcgcctgg acgcgttgga gccgatcatc cgtcgcgtcg agtag                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page